(Prototype team page) |
|||
| (One intermediate revision by the same user not shown) | |||
| Line 1: | Line 1: | ||
| − | {{ | + | <html lang="en"> |
| − | + | <head> | |
| + | <link | ||
| + | href="https://stackpath.bootstrapcdn.com/font-awesome/4.7.0/css/font-awesome.min.css" | ||
| + | rel="stylesheet" | ||
| + | integrity="sha384-wvfXpqpZZVQGK6TAh5PVlGOfQNHSoD2xbE+QkPxCAFlNEevoEH3Sl0sibVcOQVnN" | ||
| + | crossorigin="anonymous" | ||
| + | /> | ||
| + | <link | ||
| + | rel="stylesheet" | ||
| + | href="https://maxcdn.bootstrapcdn.com/bootstrap/3.4.0/css/bootstrap.min.css" | ||
| + | /> | ||
| + | <link | ||
| + | href="https://stackpath.bootstrapcdn.com/font-awesome/4.7.0/css/font-awesome.min.css" | ||
| + | rel="stylesheet" | ||
| + | integrity="sha384-wvfXpqpZZVQGK6TAh5PVlGOfQNHSoD2xbE+QkPxCAFlNEevoEH3Sl0sibVcOQVnN" | ||
| + | crossorigin="anonymous" | ||
| + | /> | ||
| + | <script src="https://ajax.googleapis.com/ajax/libs/jquery/3.4.1/jquery.min.js"></script> | ||
| + | <script src="https://cdnjs.cloudflare.com/ajax/libs/popper.js/1.14.7/umd/popper.min.js"></script> | ||
| + | <script src="https://maxcdn.bootstrapcdn.com/bootstrap/4.3.1/js/bootstrap.min.js"></script> | ||
| + | <meta charset="UTF-8" /> | ||
| + | <meta name="viewport" content="width=device-width, initial-scale=1.0" /> | ||
| + | <meta http-equiv="X-UA-Compatible" content="ie=edge" /> | ||
| + | <!-- Bootstrap start --> | ||
| + | <style> | ||
| + | |||
| + | html { | ||
| + | font-family: sans-serif; | ||
| + | -ms-text-size-adjust: 100%; | ||
| + | -webkit-text-size-adjust: 100%; | ||
| + | } | ||
| + | body { | ||
| + | margin: 0; | ||
| + | } | ||
| + | article, | ||
| + | aside, | ||
| + | details, | ||
| + | figcaption, | ||
| + | figure, | ||
| + | footer, | ||
| + | header, | ||
| + | hgroup, | ||
| + | main, | ||
| + | menu, | ||
| + | nav, | ||
| + | section, | ||
| + | summary { | ||
| + | display: block; | ||
| + | } | ||
| + | audio, | ||
| + | canvas, | ||
| + | progress, | ||
| + | video { | ||
| + | display: inline-block; | ||
| + | vertical-align: baseline; | ||
| + | } | ||
| + | audio:not([controls]) { | ||
| + | display: none; | ||
| + | height: 0; | ||
| + | } | ||
| + | [hidden], | ||
| + | template { | ||
| + | display: none; | ||
| + | } | ||
| + | a { | ||
| + | background-color: transparent; | ||
| + | } | ||
| + | a:active, | ||
| + | a:hover { | ||
| + | outline: 0; | ||
| + | } | ||
| + | abbr[title] { | ||
| + | border-bottom: none; | ||
| + | text-decoration: underline; | ||
| + | -webkit-text-decoration: underline dotted; | ||
| + | -moz-text-decoration: underline dotted; | ||
| + | text-decoration: underline dotted; | ||
| + | } | ||
| + | b, | ||
| + | strong { | ||
| + | font-weight: bold; | ||
| + | } | ||
| + | dfn { | ||
| + | font-style: italic; | ||
| + | } | ||
| + | h1 { | ||
| + | font-size: 2em; | ||
| + | margin: 0.67em 0; | ||
| + | } | ||
| + | mark { | ||
| + | background: #ff0; | ||
| + | color: #000; | ||
| + | } | ||
| + | small { | ||
| + | font-size: 80%; | ||
| + | } | ||
| + | sub, | ||
| + | sup { | ||
| + | font-size: 75%; | ||
| + | line-height: 0; | ||
| + | position: relative; | ||
| + | vertical-align: baseline; | ||
| + | } | ||
| + | sup { | ||
| + | top: -0.5em; | ||
| + | } | ||
| + | sub { | ||
| + | bottom: -0.25em; | ||
| + | } | ||
| + | img { | ||
| + | border: 0; | ||
| + | } | ||
| + | svg:not(:root) { | ||
| + | overflow: hidden; | ||
| + | } | ||
| + | figure { | ||
| + | margin: 1em 40px; | ||
| + | } | ||
| + | hr { | ||
| + | -webkit-box-sizing: content-box; | ||
| + | -moz-box-sizing: content-box; | ||
| + | box-sizing: content-box; | ||
| + | height: 0; | ||
| + | } | ||
| + | pre { | ||
| + | overflow: auto; | ||
| + | } | ||
| + | code, | ||
| + | kbd, | ||
| + | pre, | ||
| + | samp { | ||
| + | font-family: monospace, monospace; | ||
| + | font-size: 1em; | ||
| + | } | ||
| + | button, | ||
| + | input, | ||
| + | optgroup, | ||
| + | select, | ||
| + | textarea { | ||
| + | color: inherit; | ||
| + | font: inherit; | ||
| + | margin: 0; | ||
| + | } | ||
| + | button { | ||
| + | overflow: visible; | ||
| + | } | ||
| + | button, | ||
| + | select { | ||
| + | text-transform: none; | ||
| + | } | ||
| + | button, | ||
| + | html input[type="button"], | ||
| + | input[type="reset"], | ||
| + | input[type="submit"] { | ||
| + | -webkit-appearance: button; | ||
| + | cursor: pointer; | ||
| + | } | ||
| + | button[disabled], | ||
| + | html input[disabled] { | ||
| + | cursor: default; | ||
| + | } | ||
| + | button::-moz-focus-inner, | ||
| + | input::-moz-focus-inner { | ||
| + | border: 0; | ||
| + | padding: 0; | ||
| + | } | ||
| + | input { | ||
| + | line-height: normal; | ||
| + | } | ||
| + | input[type="checkbox"], | ||
| + | input[type="radio"] { | ||
| + | -webkit-box-sizing: border-box; | ||
| + | -moz-box-sizing: border-box; | ||
| + | box-sizing: border-box; | ||
| + | padding: 0; | ||
| + | } | ||
| + | input[type="number"]::-webkit-inner-spin-button, | ||
| + | input[type="number"]::-webkit-outer-spin-button { | ||
| + | height: auto; | ||
| + | } | ||
| + | input[type="search"] { | ||
| + | -webkit-appearance: textfield; | ||
| + | -webkit-box-sizing: content-box; | ||
| + | -moz-box-sizing: content-box; | ||
| + | box-sizing: content-box; | ||
| + | } | ||
| + | input[type="search"]::-webkit-search-cancel-button, | ||
| + | input[type="search"]::-webkit-search-decoration { | ||
| + | -webkit-appearance: none; | ||
| + | } | ||
| + | fieldset { | ||
| + | border: 1px solid #c0c0c0; | ||
| + | margin: 0 2px; | ||
| + | padding: 0.35em 0.625em 0.75em; | ||
| + | } | ||
| + | legend { | ||
| + | border: 0; | ||
| + | padding: 0; | ||
| + | } | ||
| + | textarea { | ||
| + | overflow: auto; | ||
| + | } | ||
| + | optgroup { | ||
| + | font-weight: bold; | ||
| + | } | ||
| + | table { | ||
| + | border-collapse: collapse; | ||
| + | border-spacing: 0; | ||
| + | } | ||
| + | td, | ||
| + | th { | ||
| + | padding: 0; | ||
| + | } | ||
| + | /*! Source: https://github.com/h5bp/html5-boilerplate/blob/master/src/css/main.css */ | ||
| + | @media print { | ||
| + | *, | ||
| + | *:before, | ||
| + | *:after { | ||
| + | color: #000 !important; | ||
| + | text-shadow: none !important; | ||
| + | background: transparent !important; | ||
| + | -webkit-box-shadow: none !important; | ||
| + | box-shadow: none !important; | ||
| + | } | ||
| + | a, | ||
| + | a:visited { | ||
| + | text-decoration: underline; | ||
| + | } | ||
| + | a[href]:after { | ||
| + | content: " (" attr(href) ")"; | ||
| + | } | ||
| + | abbr[title]:after { | ||
| + | content: " (" attr(title) ")"; | ||
| + | } | ||
| + | a[href^="#"]:after, | ||
| + | a[href^="javascript:"]:after { | ||
| + | content: ""; | ||
| + | } | ||
| + | pre, | ||
| + | blockquote { | ||
| + | border: 1px solid #999; | ||
| + | page-break-inside: avoid; | ||
| + | } | ||
| + | thead { | ||
| + | display: table-header-group; | ||
| + | } | ||
| + | tr, | ||
| + | img { | ||
| + | page-break-inside: avoid; | ||
| + | } | ||
| + | img { | ||
| + | max-width: 100% !important; | ||
| + | } | ||
| + | p, | ||
| + | h2, | ||
| + | h3 { | ||
| + | orphans: 3; | ||
| + | widows: 3; | ||
| + | } | ||
| + | h2, | ||
| + | h3 { | ||
| + | page-break-after: avoid; | ||
| + | } | ||
| + | .navbar { | ||
| + | display: none; | ||
| + | } | ||
| + | .btn > .caret, | ||
| + | .dropup > .btn > .caret { | ||
| + | border-top-color: #000 !important; | ||
| + | } | ||
| + | .label { | ||
| + | border: 1px solid #000; | ||
| + | } | ||
| + | .table { | ||
| + | border-collapse: collapse !important; | ||
| + | } | ||
| + | .table td, | ||
| + | .table th { | ||
| + | background-color: #fff !important; | ||
| + | } | ||
| + | .table-bordered th, | ||
| + | .table-bordered td { | ||
| + | border: 1px solid #ddd !important; | ||
| + | } | ||
| + | } | ||
| + | @font-face { | ||
| + | font-family: "Glyphicons Halflings"; | ||
| + | src: url("../fonts/glyphicons-halflings-regular.eot"); | ||
| + | src: url("../fonts/glyphicons-halflings-regular.eot?#iefix") format("embedded-opentype"), url("../fonts/glyphicons-halflings-regular.woff2") format("woff2"), url("../fonts/glyphicons-halflings-regular.woff") format("woff"), url("../fonts/glyphicons-halflings-regular.ttf") format("truetype"), url("../fonts/glyphicons-halflings-regular.svg#glyphicons_halflingsregular") format("svg"); | ||
| + | } | ||
| + | .glyphicon { | ||
| + | position: relative; | ||
| + | top: 1px; | ||
| + | display: inline-block; | ||
| + | font-family: "Glyphicons Halflings"; | ||
| + | font-style: normal; | ||
| + | font-weight: 400; | ||
| + | line-height: 1; | ||
| + | -webkit-font-smoothing: antialiased; | ||
| + | -moz-osx-font-smoothing: grayscale; | ||
| + | } | ||
| + | .glyphicon-asterisk:before { | ||
| + | content: "\002a"; | ||
| + | } | ||
| + | .glyphicon-plus:before { | ||
| + | content: "\002b"; | ||
| + | } | ||
| + | .glyphicon-euro:before, | ||
| + | .glyphicon-eur:before { | ||
| + | content: "\20ac"; | ||
| + | } | ||
| + | .glyphicon-minus:before { | ||
| + | content: "\2212"; | ||
| + | } | ||
| + | .glyphicon-cloud:before { | ||
| + | content: "\2601"; | ||
| + | } | ||
| + | .glyphicon-envelope:before { | ||
| + | content: "\2709"; | ||
| + | } | ||
| + | .glyphicon-pencil:before { | ||
| + | content: "\270f"; | ||
| + | } | ||
| + | .glyphicon-glass:before { | ||
| + | content: "\e001"; | ||
| + | } | ||
| + | .glyphicon-music:before { | ||
| + | content: "\e002"; | ||
| + | } | ||
| + | .glyphicon-search:before { | ||
| + | content: "\e003"; | ||
| + | } | ||
| + | .glyphicon-heart:before { | ||
| + | content: "\e005"; | ||
| + | } | ||
| + | .glyphicon-star:before { | ||
| + | content: "\e006"; | ||
| + | } | ||
| + | .glyphicon-star-empty:before { | ||
| + | content: "\e007"; | ||
| + | } | ||
| + | .glyphicon-user:before { | ||
| + | content: "\e008"; | ||
| + | } | ||
| + | .glyphicon-film:before { | ||
| + | content: "\e009"; | ||
| + | } | ||
| + | .glyphicon-th-large:before { | ||
| + | content: "\e010"; | ||
| + | } | ||
| + | .glyphicon-th:before { | ||
| + | content: "\e011"; | ||
| + | } | ||
| + | .glyphicon-th-list:before { | ||
| + | content: "\e012"; | ||
| + | } | ||
| + | .glyphicon-ok:before { | ||
| + | content: "\e013"; | ||
| + | } | ||
| + | .glyphicon-remove:before { | ||
| + | content: "\e014"; | ||
| + | } | ||
| + | .glyphicon-zoom-in:before { | ||
| + | content: "\e015"; | ||
| + | } | ||
| + | .glyphicon-zoom-out:before { | ||
| + | content: "\e016"; | ||
| + | } | ||
| + | .glyphicon-off:before { | ||
| + | content: "\e017"; | ||
| + | } | ||
| + | .glyphicon-signal:before { | ||
| + | content: "\e018"; | ||
| + | } | ||
| + | .glyphicon-cog:before { | ||
| + | content: "\e019"; | ||
| + | } | ||
| + | .glyphicon-trash:before { | ||
| + | content: "\e020"; | ||
| + | } | ||
| + | .glyphicon-home:before { | ||
| + | content: "\e021"; | ||
| + | } | ||
| + | .glyphicon-file:before { | ||
| + | content: "\e022"; | ||
| + | } | ||
| + | .glyphicon-time:before { | ||
| + | content: "\e023"; | ||
| + | } | ||
| + | .glyphicon-road:before { | ||
| + | content: "\e024"; | ||
| + | } | ||
| + | .glyphicon-download-alt:before { | ||
| + | content: "\e025"; | ||
| + | } | ||
| + | .glyphicon-download:before { | ||
| + | content: "\e026"; | ||
| + | } | ||
| + | .glyphicon-upload:before { | ||
| + | content: "\e027"; | ||
| + | } | ||
| + | .glyphicon-inbox:before { | ||
| + | content: "\e028"; | ||
| + | } | ||
| + | .glyphicon-play-circle:before { | ||
| + | content: "\e029"; | ||
| + | } | ||
| + | .glyphicon-repeat:before { | ||
| + | content: "\e030"; | ||
| + | } | ||
| + | .glyphicon-refresh:before { | ||
| + | content: "\e031"; | ||
| + | } | ||
| + | .glyphicon-list-alt:before { | ||
| + | content: "\e032"; | ||
| + | } | ||
| + | .glyphicon-lock:before { | ||
| + | content: "\e033"; | ||
| + | } | ||
| + | .glyphicon-flag:before { | ||
| + | content: "\e034"; | ||
| + | } | ||
| + | .glyphicon-headphones:before { | ||
| + | content: "\e035"; | ||
| + | } | ||
| + | .glyphicon-volume-off:before { | ||
| + | content: "\e036"; | ||
| + | } | ||
| + | .glyphicon-volume-down:before { | ||
| + | content: "\e037"; | ||
| + | } | ||
| + | .glyphicon-volume-up:before { | ||
| + | content: "\e038"; | ||
| + | } | ||
| + | .glyphicon-qrcode:before { | ||
| + | content: "\e039"; | ||
| + | } | ||
| + | .glyphicon-barcode:before { | ||
| + | content: "\e040"; | ||
| + | } | ||
| + | .glyphicon-tag:before { | ||
| + | content: "\e041"; | ||
| + | } | ||
| + | .glyphicon-tags:before { | ||
| + | content: "\e042"; | ||
| + | } | ||
| + | .glyphicon-book:before { | ||
| + | content: "\e043"; | ||
| + | } | ||
| + | .glyphicon-bookmark:before { | ||
| + | content: "\e044"; | ||
| + | } | ||
| + | .glyphicon-print:before { | ||
| + | content: "\e045"; | ||
| + | } | ||
| + | .glyphicon-camera:before { | ||
| + | content: "\e046"; | ||
| + | } | ||
| + | .glyphicon-font:before { | ||
| + | content: "\e047"; | ||
| + | } | ||
| + | .glyphicon-bold:before { | ||
| + | content: "\e048"; | ||
| + | } | ||
| + | .glyphicon-italic:before { | ||
| + | content: "\e049"; | ||
| + | } | ||
| + | .glyphicon-text-height:before { | ||
| + | content: "\e050"; | ||
| + | } | ||
| + | .glyphicon-text-width:before { | ||
| + | content: "\e051"; | ||
| + | } | ||
| + | .glyphicon-align-left:before { | ||
| + | content: "\e052"; | ||
| + | } | ||
| + | .glyphicon-align-center:before { | ||
| + | content: "\e053"; | ||
| + | } | ||
| + | .glyphicon-align-right:before { | ||
| + | content: "\e054"; | ||
| + | } | ||
| + | .glyphicon-align-justify:before { | ||
| + | content: "\e055"; | ||
| + | } | ||
| + | .glyphicon-list:before { | ||
| + | content: "\e056"; | ||
| + | } | ||
| + | .glyphicon-indent-left:before { | ||
| + | content: "\e057"; | ||
| + | } | ||
| + | .glyphicon-indent-right:before { | ||
| + | content: "\e058"; | ||
| + | } | ||
| + | .glyphicon-facetime-video:before { | ||
| + | content: "\e059"; | ||
| + | } | ||
| + | .glyphicon-picture:before { | ||
| + | content: "\e060"; | ||
| + | } | ||
| + | .glyphicon-map-marker:before { | ||
| + | content: "\e062"; | ||
| + | } | ||
| + | .glyphicon-adjust:before { | ||
| + | content: "\e063"; | ||
| + | } | ||
| + | .glyphicon-tint:before { | ||
| + | content: "\e064"; | ||
| + | } | ||
| + | .glyphicon-edit:before { | ||
| + | content: "\e065"; | ||
| + | } | ||
| + | .glyphicon-share:before { | ||
| + | content: "\e066"; | ||
| + | } | ||
| + | .glyphicon-check:before { | ||
| + | content: "\e067"; | ||
| + | } | ||
| + | .glyphicon-move:before { | ||
| + | content: "\e068"; | ||
| + | } | ||
| + | .glyphicon-step-backward:before { | ||
| + | content: "\e069"; | ||
| + | } | ||
| + | .glyphicon-fast-backward:before { | ||
| + | content: "\e070"; | ||
| + | } | ||
| + | .glyphicon-backward:before { | ||
| + | content: "\e071"; | ||
| + | } | ||
| + | .glyphicon-play:before { | ||
| + | content: "\e072"; | ||
| + | } | ||
| + | .glyphicon-pause:before { | ||
| + | content: "\e073"; | ||
| + | } | ||
| + | .glyphicon-stop:before { | ||
| + | content: "\e074"; | ||
| + | } | ||
| + | .glyphicon-forward:before { | ||
| + | content: "\e075"; | ||
| + | } | ||
| + | .glyphicon-fast-forward:before { | ||
| + | content: "\e076"; | ||
| + | } | ||
| + | .glyphicon-step-forward:before { | ||
| + | content: "\e077"; | ||
| + | } | ||
| + | .glyphicon-eject:before { | ||
| + | content: "\e078"; | ||
| + | } | ||
| + | .glyphicon-chevron-left:before { | ||
| + | content: "\e079"; | ||
| + | } | ||
| + | .glyphicon-chevron-right:before { | ||
| + | content: "\e080"; | ||
| + | } | ||
| + | .glyphicon-plus-sign:before { | ||
| + | content: "\e081"; | ||
| + | } | ||
| + | .glyphicon-minus-sign:before { | ||
| + | content: "\e082"; | ||
| + | } | ||
| + | .glyphicon-remove-sign:before { | ||
| + | content: "\e083"; | ||
| + | } | ||
| + | .glyphicon-ok-sign:before { | ||
| + | content: "\e084"; | ||
| + | } | ||
| + | .glyphicon-question-sign:before { | ||
| + | content: "\e085"; | ||
| + | } | ||
| + | .glyphicon-info-sign:before { | ||
| + | content: "\e086"; | ||
| + | } | ||
| + | .glyphicon-screenshot:before { | ||
| + | content: "\e087"; | ||
| + | } | ||
| + | .glyphicon-remove-circle:before { | ||
| + | content: "\e088"; | ||
| + | } | ||
| + | .glyphicon-ok-circle:before { | ||
| + | content: "\e089"; | ||
| + | } | ||
| + | .glyphicon-ban-circle:before { | ||
| + | content: "\e090"; | ||
| + | } | ||
| + | .glyphicon-arrow-left:before { | ||
| + | content: "\e091"; | ||
| + | } | ||
| + | .glyphicon-arrow-right:before { | ||
| + | content: "\e092"; | ||
| + | } | ||
| + | .glyphicon-arrow-up:before { | ||
| + | content: "\e093"; | ||
| + | } | ||
| + | .glyphicon-arrow-down:before { | ||
| + | content: "\e094"; | ||
| + | } | ||
| + | .glyphicon-share-alt:before { | ||
| + | content: "\e095"; | ||
| + | } | ||
| + | .glyphicon-resize-full:before { | ||
| + | content: "\e096"; | ||
| + | } | ||
| + | .glyphicon-resize-small:before { | ||
| + | content: "\e097"; | ||
| + | } | ||
| + | .glyphicon-exclamation-sign:before { | ||
| + | content: "\e101"; | ||
| + | } | ||
| + | .glyphicon-gift:before { | ||
| + | content: "\e102"; | ||
| + | } | ||
| + | .glyphicon-leaf:before { | ||
| + | content: "\e103"; | ||
| + | } | ||
| + | .glyphicon-fire:before { | ||
| + | content: "\e104"; | ||
| + | } | ||
| + | .glyphicon-eye-open:before { | ||
| + | content: "\e105"; | ||
| + | } | ||
| + | .glyphicon-eye-close:before { | ||
| + | content: "\e106"; | ||
| + | } | ||
| + | .glyphicon-warning-sign:before { | ||
| + | content: "\e107"; | ||
| + | } | ||
| + | .glyphicon-plane:before { | ||
| + | content: "\e108"; | ||
| + | } | ||
| + | .glyphicon-calendar:before { | ||
| + | content: "\e109"; | ||
| + | } | ||
| + | .glyphicon-random:before { | ||
| + | content: "\e110"; | ||
| + | } | ||
| + | .glyphicon-comment:before { | ||
| + | content: "\e111"; | ||
| + | } | ||
| + | .glyphicon-magnet:before { | ||
| + | content: "\e112"; | ||
| + | } | ||
| + | .glyphicon-chevron-up:before { | ||
| + | content: "\e113"; | ||
| + | } | ||
| + | .glyphicon-chevron-down:before { | ||
| + | content: "\e114"; | ||
| + | } | ||
| + | .glyphicon-retweet:before { | ||
| + | content: "\e115"; | ||
| + | } | ||
| + | .glyphicon-shopping-cart:before { | ||
| + | content: "\e116"; | ||
| + | } | ||
| + | .glyphicon-folder-close:before { | ||
| + | content: "\e117"; | ||
| + | } | ||
| + | .glyphicon-folder-open:before { | ||
| + | content: "\e118"; | ||
| + | } | ||
| + | .glyphicon-resize-vertical:before { | ||
| + | content: "\e119"; | ||
| + | } | ||
| + | .glyphicon-resize-horizontal:before { | ||
| + | content: "\e120"; | ||
| + | } | ||
| + | .glyphicon-hdd:before { | ||
| + | content: "\e121"; | ||
| + | } | ||
| + | .glyphicon-bullhorn:before { | ||
| + | content: "\e122"; | ||
| + | } | ||
| + | .glyphicon-bell:before { | ||
| + | content: "\e123"; | ||
| + | } | ||
| + | .glyphicon-certificate:before { | ||
| + | content: "\e124"; | ||
| + | } | ||
| + | .glyphicon-thumbs-up:before { | ||
| + | content: "\e125"; | ||
| + | } | ||
| + | .glyphicon-thumbs-down:before { | ||
| + | content: "\e126"; | ||
| + | } | ||
| + | .glyphicon-hand-right:before { | ||
| + | content: "\e127"; | ||
| + | } | ||
| + | .glyphicon-hand-left:before { | ||
| + | content: "\e128"; | ||
| + | } | ||
| + | .glyphicon-hand-up:before { | ||
| + | content: "\e129"; | ||
| + | } | ||
| + | .glyphicon-hand-down:before { | ||
| + | content: "\e130"; | ||
| + | } | ||
| + | .glyphicon-circle-arrow-right:before { | ||
| + | content: "\e131"; | ||
| + | } | ||
| + | .glyphicon-circle-arrow-left:before { | ||
| + | content: "\e132"; | ||
| + | } | ||
| + | .glyphicon-circle-arrow-up:before { | ||
| + | content: "\e133"; | ||
| + | } | ||
| + | .glyphicon-circle-arrow-down:before { | ||
| + | content: "\e134"; | ||
| + | } | ||
| + | .glyphicon-globe:before { | ||
| + | content: "\e135"; | ||
| + | } | ||
| + | .glyphicon-wrench:before { | ||
| + | content: "\e136"; | ||
| + | } | ||
| + | .glyphicon-tasks:before { | ||
| + | content: "\e137"; | ||
| + | } | ||
| + | .glyphicon-filter:before { | ||
| + | content: "\e138"; | ||
| + | } | ||
| + | .glyphicon-briefcase:before { | ||
| + | content: "\e139"; | ||
| + | } | ||
| + | .glyphicon-fullscreen:before { | ||
| + | content: "\e140"; | ||
| + | } | ||
| + | .glyphicon-dashboard:before { | ||
| + | content: "\e141"; | ||
| + | } | ||
| + | .glyphicon-paperclip:before { | ||
| + | content: "\e142"; | ||
| + | } | ||
| + | .glyphicon-heart-empty:before { | ||
| + | content: "\e143"; | ||
| + | } | ||
| + | .glyphicon-link:before { | ||
| + | content: "\e144"; | ||
| + | } | ||
| + | .glyphicon-phone:before { | ||
| + | content: "\e145"; | ||
| + | } | ||
| + | .glyphicon-pushpin:before { | ||
| + | content: "\e146"; | ||
| + | } | ||
| + | .glyphicon-usd:before { | ||
| + | content: "\e148"; | ||
| + | } | ||
| + | .glyphicon-gbp:before { | ||
| + | content: "\e149"; | ||
| + | } | ||
| + | .glyphicon-sort:before { | ||
| + | content: "\e150"; | ||
| + | } | ||
| + | .glyphicon-sort-by-alphabet:before { | ||
| + | content: "\e151"; | ||
| + | } | ||
| + | .glyphicon-sort-by-alphabet-alt:before { | ||
| + | content: "\e152"; | ||
| + | } | ||
| + | .glyphicon-sort-by-order:before { | ||
| + | content: "\e153"; | ||
| + | } | ||
| + | .glyphicon-sort-by-order-alt:before { | ||
| + | content: "\e154"; | ||
| + | } | ||
| + | .glyphicon-sort-by-attributes:before { | ||
| + | content: "\e155"; | ||
| + | } | ||
| + | .glyphicon-sort-by-attributes-alt:before { | ||
| + | content: "\e156"; | ||
| + | } | ||
| + | .glyphicon-unchecked:before { | ||
| + | content: "\e157"; | ||
| + | } | ||
| + | .glyphicon-expand:before { | ||
| + | content: "\e158"; | ||
| + | } | ||
| + | .glyphicon-collapse-down:before { | ||
| + | content: "\e159"; | ||
| + | } | ||
| + | .glyphicon-collapse-up:before { | ||
| + | content: "\e160"; | ||
| + | } | ||
| + | .glyphicon-log-in:before { | ||
| + | content: "\e161"; | ||
| + | } | ||
| + | .glyphicon-flash:before { | ||
| + | content: "\e162"; | ||
| + | } | ||
| + | .glyphicon-log-out:before { | ||
| + | content: "\e163"; | ||
| + | } | ||
| + | .glyphicon-new-window:before { | ||
| + | content: "\e164"; | ||
| + | } | ||
| + | .glyphicon-record:before { | ||
| + | content: "\e165"; | ||
| + | } | ||
| + | .glyphicon-save:before { | ||
| + | content: "\e166"; | ||
| + | } | ||
| + | .glyphicon-open:before { | ||
| + | content: "\e167"; | ||
| + | } | ||
| + | .glyphicon-saved:before { | ||
| + | content: "\e168"; | ||
| + | } | ||
| + | .glyphicon-import:before { | ||
| + | content: "\e169"; | ||
| + | } | ||
| + | .glyphicon-export:before { | ||
| + | content: "\e170"; | ||
| + | } | ||
| + | .glyphicon-send:before { | ||
| + | content: "\e171"; | ||
| + | } | ||
| + | .glyphicon-floppy-disk:before { | ||
| + | content: "\e172"; | ||
| + | } | ||
| + | .glyphicon-floppy-saved:before { | ||
| + | content: "\e173"; | ||
| + | } | ||
| + | .glyphicon-floppy-remove:before { | ||
| + | content: "\e174"; | ||
| + | } | ||
| + | .glyphicon-floppy-save:before { | ||
| + | content: "\e175"; | ||
| + | } | ||
| + | .glyphicon-floppy-open:before { | ||
| + | content: "\e176"; | ||
| + | } | ||
| + | .glyphicon-credit-card:before { | ||
| + | content: "\e177"; | ||
| + | } | ||
| + | .glyphicon-transfer:before { | ||
| + | content: "\e178"; | ||
| + | } | ||
| + | .glyphicon-cutlery:before { | ||
| + | content: "\e179"; | ||
| + | } | ||
| + | .glyphicon-header:before { | ||
| + | content: "\e180"; | ||
| + | } | ||
| + | .glyphicon-compressed:before { | ||
| + | content: "\e181"; | ||
| + | } | ||
| + | .glyphicon-earphone:before { | ||
| + | content: "\e182"; | ||
| + | } | ||
| + | .glyphicon-phone-alt:before { | ||
| + | content: "\e183"; | ||
| + | } | ||
| + | .glyphicon-tower:before { | ||
| + | content: "\e184"; | ||
| + | } | ||
| + | .glyphicon-stats:before { | ||
| + | content: "\e185"; | ||
| + | } | ||
| + | .glyphicon-sd-video:before { | ||
| + | content: "\e186"; | ||
| + | } | ||
| + | .glyphicon-hd-video:before { | ||
| + | content: "\e187"; | ||
| + | } | ||
| + | .glyphicon-subtitles:before { | ||
| + | content: "\e188"; | ||
| + | } | ||
| + | .glyphicon-sound-stereo:before { | ||
| + | content: "\e189"; | ||
| + | } | ||
| + | .glyphicon-sound-dolby:before { | ||
| + | content: "\e190"; | ||
| + | } | ||
| + | .glyphicon-sound-5-1:before { | ||
| + | content: "\e191"; | ||
| + | } | ||
| + | .glyphicon-sound-6-1:before { | ||
| + | content: "\e192"; | ||
| + | } | ||
| + | .glyphicon-sound-7-1:before { | ||
| + | content: "\e193"; | ||
| + | } | ||
| + | .glyphicon-copyright-mark:before { | ||
| + | content: "\e194"; | ||
| + | } | ||
| + | .glyphicon-registration-mark:before { | ||
| + | content: "\e195"; | ||
| + | } | ||
| + | .glyphicon-cloud-download:before { | ||
| + | content: "\e197"; | ||
| + | } | ||
| + | .glyphicon-cloud-upload:before { | ||
| + | content: "\e198"; | ||
| + | } | ||
| + | .glyphicon-tree-conifer:before { | ||
| + | content: "\e199"; | ||
| + | } | ||
| + | .glyphicon-tree-deciduous:before { | ||
| + | content: "\e200"; | ||
| + | } | ||
| + | .glyphicon-cd:before { | ||
| + | content: "\e201"; | ||
| + | } | ||
| + | .glyphicon-save-file:before { | ||
| + | content: "\e202"; | ||
| + | } | ||
| + | .glyphicon-open-file:before { | ||
| + | content: "\e203"; | ||
| + | } | ||
| + | .glyphicon-level-up:before { | ||
| + | content: "\e204"; | ||
| + | } | ||
| + | .glyphicon-copy:before { | ||
| + | content: "\e205"; | ||
| + | } | ||
| + | .glyphicon-paste:before { | ||
| + | content: "\e206"; | ||
| + | } | ||
| + | .glyphicon-alert:before { | ||
| + | content: "\e209"; | ||
| + | } | ||
| + | .glyphicon-equalizer:before { | ||
| + | content: "\e210"; | ||
| + | } | ||
| + | .glyphicon-king:before { | ||
| + | content: "\e211"; | ||
| + | } | ||
| + | .glyphicon-queen:before { | ||
| + | content: "\e212"; | ||
| + | } | ||
| + | .glyphicon-pawn:before { | ||
| + | content: "\e213"; | ||
| + | } | ||
| + | .glyphicon-bishop:before { | ||
| + | content: "\e214"; | ||
| + | } | ||
| + | .glyphicon-knight:before { | ||
| + | content: "\e215"; | ||
| + | } | ||
| + | .glyphicon-baby-formula:before { | ||
| + | content: "\e216"; | ||
| + | } | ||
| + | .glyphicon-tent:before { | ||
| + | content: "\26fa"; | ||
| + | } | ||
| + | .glyphicon-blackboard:before { | ||
| + | content: "\e218"; | ||
| + | } | ||
| + | .glyphicon-bed:before { | ||
| + | content: "\e219"; | ||
| + | } | ||
| + | .glyphicon-apple:before { | ||
| + | content: "\f8ff"; | ||
| + | } | ||
| + | .glyphicon-erase:before { | ||
| + | content: "\e221"; | ||
| + | } | ||
| + | .glyphicon-hourglass:before { | ||
| + | content: "\231b"; | ||
| + | } | ||
| + | .glyphicon-lamp:before { | ||
| + | content: "\e223"; | ||
| + | } | ||
| + | .glyphicon-duplicate:before { | ||
| + | content: "\e224"; | ||
| + | } | ||
| + | .glyphicon-piggy-bank:before { | ||
| + | content: "\e225"; | ||
| + | } | ||
| + | .glyphicon-scissors:before { | ||
| + | content: "\e226"; | ||
| + | } | ||
| + | .glyphicon-bitcoin:before { | ||
| + | content: "\e227"; | ||
| + | } | ||
| + | .glyphicon-btc:before { | ||
| + | content: "\e227"; | ||
| + | } | ||
| + | .glyphicon-xbt:before { | ||
| + | content: "\e227"; | ||
| + | } | ||
| + | .glyphicon-yen:before { | ||
| + | content: "\00a5"; | ||
| + | } | ||
| + | .glyphicon-jpy:before { | ||
| + | content: "\00a5"; | ||
| + | } | ||
| + | .glyphicon-ruble:before { | ||
| + | content: "\20bd"; | ||
| + | } | ||
| + | .glyphicon-rub:before { | ||
| + | content: "\20bd"; | ||
| + | } | ||
| + | .glyphicon-scale:before { | ||
| + | content: "\e230"; | ||
| + | } | ||
| + | .glyphicon-ice-lolly:before { | ||
| + | content: "\e231"; | ||
| + | } | ||
| + | .glyphicon-ice-lolly-tasted:before { | ||
| + | content: "\e232"; | ||
| + | } | ||
| + | .glyphicon-education:before { | ||
| + | content: "\e233"; | ||
| + | } | ||
| + | .glyphicon-option-horizontal:before { | ||
| + | content: "\e234"; | ||
| + | } | ||
| + | .glyphicon-option-vertical:before { | ||
| + | content: "\e235"; | ||
| + | } | ||
| + | .glyphicon-menu-hamburger:before { | ||
| + | content: "\e236"; | ||
| + | } | ||
| + | .glyphicon-modal-window:before { | ||
| + | content: "\e237"; | ||
| + | } | ||
| + | .glyphicon-oil:before { | ||
| + | content: "\e238"; | ||
| + | } | ||
| + | .glyphicon-grain:before { | ||
| + | content: "\e239"; | ||
| + | } | ||
| + | .glyphicon-sunglasses:before { | ||
| + | content: "\e240"; | ||
| + | } | ||
| + | .glyphicon-text-size:before { | ||
| + | content: "\e241"; | ||
| + | } | ||
| + | .glyphicon-text-color:before { | ||
| + | content: "\e242"; | ||
| + | } | ||
| + | .glyphicon-text-background:before { | ||
| + | content: "\e243"; | ||
| + | } | ||
| + | .glyphicon-object-align-top:before { | ||
| + | content: "\e244"; | ||
| + | } | ||
| + | .glyphicon-object-align-bottom:before { | ||
| + | content: "\e245"; | ||
| + | } | ||
| + | .glyphicon-object-align-horizontal:before { | ||
| + | content: "\e246"; | ||
| + | } | ||
| + | .glyphicon-object-align-left:before { | ||
| + | content: "\e247"; | ||
| + | } | ||
| + | .glyphicon-object-align-vertical:before { | ||
| + | content: "\e248"; | ||
| + | } | ||
| + | .glyphicon-object-align-right:before { | ||
| + | content: "\e249"; | ||
| + | } | ||
| + | .glyphicon-triangle-right:before { | ||
| + | content: "\e250"; | ||
| + | } | ||
| + | .glyphicon-triangle-left:before { | ||
| + | content: "\e251"; | ||
| + | } | ||
| + | .glyphicon-triangle-bottom:before { | ||
| + | content: "\e252"; | ||
| + | } | ||
| + | .glyphicon-triangle-top:before { | ||
| + | content: "\e253"; | ||
| + | } | ||
| + | .glyphicon-console:before { | ||
| + | content: "\e254"; | ||
| + | } | ||
| + | .glyphicon-superscript:before { | ||
| + | content: "\e255"; | ||
| + | } | ||
| + | .glyphicon-subscript:before { | ||
| + | content: "\e256"; | ||
| + | } | ||
| + | .glyphicon-menu-left:before { | ||
| + | content: "\e257"; | ||
| + | } | ||
| + | .glyphicon-menu-right:before { | ||
| + | content: "\e258"; | ||
| + | } | ||
| + | .glyphicon-menu-down:before { | ||
| + | content: "\e259"; | ||
| + | } | ||
| + | .glyphicon-menu-up:before { | ||
| + | content: "\e260"; | ||
| + | } | ||
| + | * { | ||
| + | -webkit-box-sizing: border-box; | ||
| + | -moz-box-sizing: border-box; | ||
| + | box-sizing: border-box; | ||
| + | } | ||
| + | *:before, | ||
| + | *:after { | ||
| + | -webkit-box-sizing: border-box; | ||
| + | -moz-box-sizing: border-box; | ||
| + | box-sizing: border-box; | ||
| + | } | ||
| + | html { | ||
| + | font-size: 10px; | ||
| + | -webkit-tap-highlight-color: rgba(0, 0, 0, 0); | ||
| + | } | ||
| + | body { | ||
| + | font-family: "Helvetica Neue", Helvetica, Arial, sans-serif; | ||
| + | font-size: 14px; | ||
| + | line-height: 1.42857143; | ||
| + | color: #333333; | ||
| + | background-color: #fff; | ||
| + | } | ||
| + | input, | ||
| + | button, | ||
| + | select, | ||
| + | textarea { | ||
| + | font-family: inherit; | ||
| + | font-size: inherit; | ||
| + | line-height: inherit; | ||
| + | } | ||
| + | a { | ||
| + | color: #337ab7; | ||
| + | text-decoration: none; | ||
| + | } | ||
| + | a:hover, | ||
| + | a:focus { | ||
| + | color: #23527c; | ||
| + | text-decoration: underline; | ||
| + | } | ||
| + | a:focus { | ||
| + | outline: 5px auto -webkit-focus-ring-color; | ||
| + | outline-offset: -2px; | ||
| + | } | ||
| + | figure { | ||
| + | margin: 0; | ||
| + | } | ||
| + | img { | ||
| + | vertical-align: middle; | ||
| + | } | ||
| + | .img-responsive, | ||
| + | .thumbnail > img, | ||
| + | .thumbnail a > img, | ||
| + | .carousel-inner > .item > img, | ||
| + | .carousel-inner > .item > a > img { | ||
| + | display: block; | ||
| + | max-width: 100%; | ||
| + | height: auto; | ||
| + | } | ||
| + | .img-rounded { | ||
| + | border-radius: 6px; | ||
| + | } | ||
| + | .img-thumbnail { | ||
| + | padding: 4px; | ||
| + | line-height: 1.42857143; | ||
| + | background-color: #fff; | ||
| + | border: 1px solid #ddd; | ||
| + | border-radius: 4px; | ||
| + | -webkit-transition: all 0.2s ease-in-out; | ||
| + | -o-transition: all 0.2s ease-in-out; | ||
| + | transition: all 0.2s ease-in-out; | ||
| + | display: inline-block; | ||
| + | max-width: 100%; | ||
| + | height: auto; | ||
| + | } | ||
| + | .img-circle { | ||
| + | border-radius: 50%; | ||
| + | } | ||
| + | hr { | ||
| + | margin-top: 20px; | ||
| + | margin-bottom: 20px; | ||
| + | border: 0; | ||
| + | border-top: 1px solid #eeeeee; | ||
| + | } | ||
| + | .sr-only { | ||
| + | position: absolute; | ||
| + | width: 1px; | ||
| + | height: 1px; | ||
| + | padding: 0; | ||
| + | margin: -1px; | ||
| + | overflow: hidden; | ||
| + | clip: rect(0, 0, 0, 0); | ||
| + | border: 0; | ||
| + | } | ||
| + | .sr-only-focusable:active, | ||
| + | .sr-only-focusable:focus { | ||
| + | position: static; | ||
| + | width: auto; | ||
| + | height: auto; | ||
| + | margin: 0; | ||
| + | overflow: visible; | ||
| + | clip: auto; | ||
| + | } | ||
| + | [role="button"] { | ||
| + | cursor: pointer; | ||
| + | } | ||
| + | h1, | ||
| + | h2, | ||
| + | h3, | ||
| + | h4, | ||
| + | h5, | ||
| + | h6, | ||
| + | .h1, | ||
| + | .h2, | ||
| + | .h3, | ||
| + | .h4, | ||
| + | .h5, | ||
| + | .h6 { | ||
| + | font-family: inherit; | ||
| + | font-weight: 500; | ||
| + | line-height: 1.1; | ||
| + | color: inherit; | ||
| + | } | ||
| + | h1 small, | ||
| + | h2 small, | ||
| + | h3 small, | ||
| + | h4 small, | ||
| + | h5 small, | ||
| + | h6 small, | ||
| + | .h1 small, | ||
| + | .h2 small, | ||
| + | .h3 small, | ||
| + | .h4 small, | ||
| + | .h5 small, | ||
| + | .h6 small, | ||
| + | h1 .small, | ||
| + | h2 .small, | ||
| + | h3 .small, | ||
| + | h4 .small, | ||
| + | h5 .small, | ||
| + | h6 .small, | ||
| + | .h1 .small, | ||
| + | .h2 .small, | ||
| + | .h3 .small, | ||
| + | .h4 .small, | ||
| + | .h5 .small, | ||
| + | .h6 .small { | ||
| + | font-weight: 400; | ||
| + | line-height: 1; | ||
| + | color: #777777; | ||
| + | } | ||
| + | h1, | ||
| + | .h1, | ||
| + | h2, | ||
| + | .h2, | ||
| + | h3, | ||
| + | .h3 { | ||
| + | margin-top: 20px; | ||
| + | margin-bottom: 10px; | ||
| + | } | ||
| + | h1 small, | ||
| + | .h1 small, | ||
| + | h2 small, | ||
| + | .h2 small, | ||
| + | h3 small, | ||
| + | .h3 small, | ||
| + | h1 .small, | ||
| + | .h1 .small, | ||
| + | h2 .small, | ||
| + | .h2 .small, | ||
| + | h3 .small, | ||
| + | .h3 .small { | ||
| + | font-size: 65%; | ||
| + | } | ||
| + | h4, | ||
| + | .h4, | ||
| + | h5, | ||
| + | .h5, | ||
| + | h6, | ||
| + | .h6 { | ||
| + | margin-top: 10px; | ||
| + | margin-bottom: 10px; | ||
| + | } | ||
| + | h4 small, | ||
| + | .h4 small, | ||
| + | h5 small, | ||
| + | .h5 small, | ||
| + | h6 small, | ||
| + | .h6 small, | ||
| + | h4 .small, | ||
| + | .h4 .small, | ||
| + | h5 .small, | ||
| + | .h5 .small, | ||
| + | h6 .small, | ||
| + | .h6 .small { | ||
| + | font-size: 75%; | ||
| + | } | ||
| + | h1, | ||
| + | .h1 { | ||
| + | font-size: 36px; | ||
| + | } | ||
| + | h2, | ||
| + | .h2 { | ||
| + | font-size: 30px; | ||
| + | } | ||
| + | h3, | ||
| + | .h3 { | ||
| + | font-size: 24px; | ||
| + | } | ||
| + | h4, | ||
| + | .h4 { | ||
| + | font-size: 18px; | ||
| + | } | ||
| + | h5, | ||
| + | .h5 { | ||
| + | font-size: 14px; | ||
| + | } | ||
| + | h6, | ||
| + | .h6 { | ||
| + | font-size: 12px; | ||
| + | } | ||
| + | p { | ||
| + | margin: 0 0 10px; | ||
| + | } | ||
| + | .lead { | ||
| + | margin-bottom: 20px; | ||
| + | font-size: 16px; | ||
| + | font-weight: 300; | ||
| + | line-height: 1.4; | ||
| + | } | ||
| + | @media (min-width: 768px) { | ||
| + | .lead { | ||
| + | font-size: 21px; | ||
| + | } | ||
| + | } | ||
| + | small, | ||
| + | .small { | ||
| + | font-size: 85%; | ||
| + | } | ||
| + | mark, | ||
| + | .mark { | ||
| + | padding: 0.2em; | ||
| + | background-color: #fcf8e3; | ||
| + | } | ||
| + | .text-left { | ||
| + | text-align: left; | ||
| + | } | ||
| + | .text-right { | ||
| + | text-align: right; | ||
| + | } | ||
| + | .text-center { | ||
| + | text-align: center; | ||
| + | } | ||
| + | .text-justify { | ||
| + | text-align: justify; | ||
| + | } | ||
| + | .text-nowrap { | ||
| + | white-space: nowrap; | ||
| + | } | ||
| + | .text-lowercase { | ||
| + | text-transform: lowercase; | ||
| + | } | ||
| + | .text-uppercase { | ||
| + | text-transform: uppercase; | ||
| + | } | ||
| + | .text-capitalize { | ||
| + | text-transform: capitalize; | ||
| + | } | ||
| + | .text-muted { | ||
| + | color: #777777; | ||
| + | } | ||
| + | .text-primary { | ||
| + | color: #337ab7; | ||
| + | } | ||
| + | a.text-primary:hover, | ||
| + | a.text-primary:focus { | ||
| + | color: #286090; | ||
| + | } | ||
| + | .text-success { | ||
| + | color: #3c763d; | ||
| + | } | ||
| + | a.text-success:hover, | ||
| + | a.text-success:focus { | ||
| + | color: #2b542c; | ||
| + | } | ||
| + | .text-info { | ||
| + | color: #31708f; | ||
| + | } | ||
| + | a.text-info:hover, | ||
| + | a.text-info:focus { | ||
| + | color: #245269; | ||
| + | } | ||
| + | .text-warning { | ||
| + | color: #8a6d3b; | ||
| + | } | ||
| + | a.text-warning:hover, | ||
| + | a.text-warning:focus { | ||
| + | color: #66512c; | ||
| + | } | ||
| + | .text-danger { | ||
| + | color: #a94442; | ||
| + | } | ||
| + | a.text-danger:hover, | ||
| + | a.text-danger:focus { | ||
| + | color: #843534; | ||
| + | } | ||
| + | .bg-primary { | ||
| + | color: #fff; | ||
| + | background-color: #337ab7; | ||
| + | } | ||
| + | a.bg-primary:hover, | ||
| + | a.bg-primary:focus { | ||
| + | background-color: #286090; | ||
| + | } | ||
| + | .bg-success { | ||
| + | background-color: #dff0d8; | ||
| + | } | ||
| + | a.bg-success:hover, | ||
| + | a.bg-success:focus { | ||
| + | background-color: #c1e2b3; | ||
| + | } | ||
| + | .bg-info { | ||
| + | background-color: #d9edf7; | ||
| + | } | ||
| + | a.bg-info:hover, | ||
| + | a.bg-info:focus { | ||
| + | background-color: #afd9ee; | ||
| + | } | ||
| + | .bg-warning { | ||
| + | background-color: #fcf8e3; | ||
| + | } | ||
| + | a.bg-warning:hover, | ||
| + | a.bg-warning:focus { | ||
| + | background-color: #f7ecb5; | ||
| + | } | ||
| + | .bg-danger { | ||
| + | background-color: #f2dede; | ||
| + | } | ||
| + | a.bg-danger:hover, | ||
| + | a.bg-danger:focus { | ||
| + | background-color: #e4b9b9; | ||
| + | } | ||
| + | .page-header { | ||
| + | padding-bottom: 9px; | ||
| + | margin: 40px 0 20px; | ||
| + | border-bottom: 1px solid #eeeeee; | ||
| + | } | ||
| + | ul, | ||
| + | ol { | ||
| + | margin-top: 0; | ||
| + | margin-bottom: 10px; | ||
| + | } | ||
| + | ul ul, | ||
| + | ol ul, | ||
| + | ul ol, | ||
| + | ol ol { | ||
| + | margin-bottom: 0; | ||
| + | } | ||
| + | .list-unstyled { | ||
| + | padding-left: 0; | ||
| + | list-style: none; | ||
| + | } | ||
| + | .list-inline { | ||
| + | padding-left: 0; | ||
| + | list-style: none; | ||
| + | margin-left: -5px; | ||
| + | } | ||
| + | .list-inline > li { | ||
| + | display: inline-block; | ||
| + | padding-right: 5px; | ||
| + | padding-left: 5px; | ||
| + | } | ||
| + | dl { | ||
| + | margin-top: 0; | ||
| + | margin-bottom: 20px; | ||
| + | } | ||
| + | dt, | ||
| + | dd { | ||
| + | line-height: 1.42857143; | ||
| + | } | ||
| + | dt { | ||
| + | font-weight: 700; | ||
| + | } | ||
| + | dd { | ||
| + | margin-left: 0; | ||
| + | } | ||
| + | @media (min-width: 768px) { | ||
| + | .dl-horizontal dt { | ||
| + | float: left; | ||
| + | width: 160px; | ||
| + | clear: left; | ||
| + | text-align: right; | ||
| + | overflow: hidden; | ||
| + | text-overflow: ellipsis; | ||
| + | white-space: nowrap; | ||
| + | } | ||
| + | .dl-horizontal dd { | ||
| + | margin-left: 180px; | ||
| + | } | ||
| + | } | ||
| + | abbr[title], | ||
| + | abbr[data-original-title] { | ||
| + | cursor: help; | ||
| + | } | ||
| + | .initialism { | ||
| + | font-size: 90%; | ||
| + | text-transform: uppercase; | ||
| + | } | ||
| + | blockquote { | ||
| + | padding: 10px 20px; | ||
| + | margin: 0 0 20px; | ||
| + | font-size: 17.5px; | ||
| + | border-left: 5px solid #eeeeee; | ||
| + | } | ||
| + | blockquote p:last-child, | ||
| + | blockquote ul:last-child, | ||
| + | blockquote ol:last-child { | ||
| + | margin-bottom: 0; | ||
| + | } | ||
| + | blockquote footer, | ||
| + | blockquote small, | ||
| + | blockquote .small { | ||
| + | display: block; | ||
| + | font-size: 80%; | ||
| + | line-height: 1.42857143; | ||
| + | color: #777777; | ||
| + | } | ||
| + | blockquote footer:before, | ||
| + | blockquote small:before, | ||
| + | blockquote .small:before { | ||
| + | content: "\2014 \00A0"; | ||
| + | } | ||
| + | .blockquote-reverse, | ||
| + | blockquote.pull-right { | ||
| + | padding-right: 15px; | ||
| + | padding-left: 0; | ||
| + | text-align: right; | ||
| + | border-right: 5px solid #eeeeee; | ||
| + | border-left: 0; | ||
| + | } | ||
| + | .blockquote-reverse footer:before, | ||
| + | blockquote.pull-right footer:before, | ||
| + | .blockquote-reverse small:before, | ||
| + | blockquote.pull-right small:before, | ||
| + | .blockquote-reverse .small:before, | ||
| + | blockquote.pull-right .small:before { | ||
| + | content: ""; | ||
| + | } | ||
| + | .blockquote-reverse footer:after, | ||
| + | blockquote.pull-right footer:after, | ||
| + | .blockquote-reverse small:after, | ||
| + | blockquote.pull-right small:after, | ||
| + | .blockquote-reverse .small:after, | ||
| + | blockquote.pull-right .small:after { | ||
| + | content: "\00A0 \2014"; | ||
| + | } | ||
| + | address { | ||
| + | margin-bottom: 20px; | ||
| + | font-style: normal; | ||
| + | line-height: 1.42857143; | ||
| + | } | ||
| + | code, | ||
| + | kbd, | ||
| + | pre, | ||
| + | samp { | ||
| + | font-family: Menlo, Monaco, Consolas, "Courier New", monospace; | ||
| + | } | ||
| + | code { | ||
| + | padding: 2px 4px; | ||
| + | font-size: 90%; | ||
| + | color: #c7254e; | ||
| + | background-color: #f9f2f4; | ||
| + | border-radius: 4px; | ||
| + | } | ||
| + | kbd { | ||
| + | padding: 2px 4px; | ||
| + | font-size: 90%; | ||
| + | color: #fff; | ||
| + | background-color: #333; | ||
| + | border-radius: 3px; | ||
| + | -webkit-box-shadow: inset 0 -1px 0 rgba(0, 0, 0, 0.25); | ||
| + | box-shadow: inset 0 -1px 0 rgba(0, 0, 0, 0.25); | ||
| + | } | ||
| + | kbd kbd { | ||
| + | padding: 0; | ||
| + | font-size: 100%; | ||
| + | font-weight: 700; | ||
| + | -webkit-box-shadow: none; | ||
| + | box-shadow: none; | ||
| + | } | ||
| + | pre { | ||
| + | display: block; | ||
| + | padding: 9.5px; | ||
| + | margin: 0 0 10px; | ||
| + | font-size: 13px; | ||
| + | line-height: 1.42857143; | ||
| + | color: #333333; | ||
| + | word-break: break-all; | ||
| + | word-wrap: break-word; | ||
| + | background-color: #f5f5f5; | ||
| + | border: 1px solid #ccc; | ||
| + | border-radius: 4px; | ||
| + | } | ||
| + | pre code { | ||
| + | padding: 0; | ||
| + | font-size: inherit; | ||
| + | color: inherit; | ||
| + | white-space: pre-wrap; | ||
| + | background-color: transparent; | ||
| + | border-radius: 0; | ||
| + | } | ||
| + | .pre-scrollable { | ||
| + | max-height: 340px; | ||
| + | overflow-y: scroll; | ||
| + | } | ||
| + | .container { | ||
| + | padding-right: 15px; | ||
| + | padding-left: 15px; | ||
| + | margin-right: auto; | ||
| + | margin-left: auto; | ||
| + | } | ||
| + | @media (min-width: 768px) { | ||
| + | .container { | ||
| + | width: 750px; | ||
| + | } | ||
| + | } | ||
| + | @media (min-width: 992px) { | ||
| + | .container { | ||
| + | width: 970px; | ||
| + | } | ||
| + | } | ||
| + | @media (min-width: 1200px) { | ||
| + | .container { | ||
| + | width: 1170px; | ||
| + | } | ||
| + | } | ||
| + | .container-fluid { | ||
| + | padding-right: 15px; | ||
| + | padding-left: 15px; | ||
| + | margin-right: auto; | ||
| + | margin-left: auto; | ||
| + | } | ||
| + | .row { | ||
| + | margin-right: -15px; | ||
| + | margin-left: -15px; | ||
| + | } | ||
| + | .row-no-gutters { | ||
| + | margin-right: 0; | ||
| + | margin-left: 0; | ||
| + | } | ||
| + | .row-no-gutters [class*="col-"] { | ||
| + | padding-right: 0; | ||
| + | padding-left: 0; | ||
| + | } | ||
| + | .col-xs-1, | ||
| + | .col-sm-1, | ||
| + | .col-md-1, | ||
| + | .col-lg-1, | ||
| + | .col-xs-2, | ||
| + | .col-sm-2, | ||
| + | .col-md-2, | ||
| + | .col-lg-2, | ||
| + | .col-xs-3, | ||
| + | .col-sm-3, | ||
| + | .col-md-3, | ||
| + | .col-lg-3, | ||
| + | .col-xs-4, | ||
| + | .col-sm-4, | ||
| + | .col-md-4, | ||
| + | .col-lg-4, | ||
| + | .col-xs-5, | ||
| + | .col-sm-5, | ||
| + | .col-md-5, | ||
| + | .col-lg-5, | ||
| + | .col-xs-6, | ||
| + | .col-sm-6, | ||
| + | .col-md-6, | ||
| + | .col-lg-6, | ||
| + | .col-xs-7, | ||
| + | .col-sm-7, | ||
| + | .col-md-7, | ||
| + | .col-lg-7, | ||
| + | .col-xs-8, | ||
| + | .col-sm-8, | ||
| + | .col-md-8, | ||
| + | .col-lg-8, | ||
| + | .col-xs-9, | ||
| + | .col-sm-9, | ||
| + | .col-md-9, | ||
| + | .col-lg-9, | ||
| + | .col-xs-10, | ||
| + | .col-sm-10, | ||
| + | .col-md-10, | ||
| + | .col-lg-10, | ||
| + | .col-xs-11, | ||
| + | .col-sm-11, | ||
| + | .col-md-11, | ||
| + | .col-lg-11, | ||
| + | .col-xs-12, | ||
| + | .col-sm-12, | ||
| + | .col-md-12, | ||
| + | .col-lg-12 { | ||
| + | position: relative; | ||
| + | min-height: 1px; | ||
| + | padding-right: 15px; | ||
| + | padding-left: 15px; | ||
| + | } | ||
| + | .col-xs-1, | ||
| + | .col-xs-2, | ||
| + | .col-xs-3, | ||
| + | .col-xs-4, | ||
| + | .col-xs-5, | ||
| + | .col-xs-6, | ||
| + | .col-xs-7, | ||
| + | .col-xs-8, | ||
| + | .col-xs-9, | ||
| + | .col-xs-10, | ||
| + | .col-xs-11, | ||
| + | .col-xs-12 { | ||
| + | float: left; | ||
| + | } | ||
| + | .col-xs-12 { | ||
| + | width: 100%; | ||
| + | } | ||
| + | .col-xs-11 { | ||
| + | width: 91.66666667%; | ||
| + | } | ||
| + | .col-xs-10 { | ||
| + | width: 83.33333333%; | ||
| + | } | ||
| + | .col-xs-9 { | ||
| + | width: 75%; | ||
| + | } | ||
| + | .col-xs-8 { | ||
| + | width: 66.66666667%; | ||
| + | } | ||
| + | .col-xs-7 { | ||
| + | width: 58.33333333%; | ||
| + | } | ||
| + | .col-xs-6 { | ||
| + | width: 50%; | ||
| + | } | ||
| + | .col-xs-5 { | ||
| + | width: 41.66666667%; | ||
| + | } | ||
| + | .col-xs-4 { | ||
| + | width: 33.33333333%; | ||
| + | } | ||
| + | .col-xs-3 { | ||
| + | width: 25%; | ||
| + | } | ||
| + | .col-xs-2 { | ||
| + | width: 16.66666667%; | ||
| + | } | ||
| + | .col-xs-1 { | ||
| + | width: 8.33333333%; | ||
| + | } | ||
| + | .col-xs-pull-12 { | ||
| + | right: 100%; | ||
| + | } | ||
| + | .col-xs-pull-11 { | ||
| + | right: 91.66666667%; | ||
| + | } | ||
| + | .col-xs-pull-10 { | ||
| + | right: 83.33333333%; | ||
| + | } | ||
| + | .col-xs-pull-9 { | ||
| + | right: 75%; | ||
| + | } | ||
| + | .col-xs-pull-8 { | ||
| + | right: 66.66666667%; | ||
| + | } | ||
| + | .col-xs-pull-7 { | ||
| + | right: 58.33333333%; | ||
| + | } | ||
| + | .col-xs-pull-6 { | ||
| + | right: 50%; | ||
| + | } | ||
| + | .col-xs-pull-5 { | ||
| + | right: 41.66666667%; | ||
| + | } | ||
| + | .col-xs-pull-4 { | ||
| + | right: 33.33333333%; | ||
| + | } | ||
| + | .col-xs-pull-3 { | ||
| + | right: 25%; | ||
| + | } | ||
| + | .col-xs-pull-2 { | ||
| + | right: 16.66666667%; | ||
| + | } | ||
| + | .col-xs-pull-1 { | ||
| + | right: 8.33333333%; | ||
| + | } | ||
| + | .col-xs-pull-0 { | ||
| + | right: auto; | ||
| + | } | ||
| + | .col-xs-push-12 { | ||
| + | left: 100%; | ||
| + | } | ||
| + | .col-xs-push-11 { | ||
| + | left: 91.66666667%; | ||
| + | } | ||
| + | .col-xs-push-10 { | ||
| + | left: 83.33333333%; | ||
| + | } | ||
| + | .col-xs-push-9 { | ||
| + | left: 75%; | ||
| + | } | ||
| + | .col-xs-push-8 { | ||
| + | left: 66.66666667%; | ||
| + | } | ||
| + | .col-xs-push-7 { | ||
| + | left: 58.33333333%; | ||
| + | } | ||
| + | .col-xs-push-6 { | ||
| + | left: 50%; | ||
| + | } | ||
| + | .col-xs-push-5 { | ||
| + | left: 41.66666667%; | ||
| + | } | ||
| + | .col-xs-push-4 { | ||
| + | left: 33.33333333%; | ||
| + | } | ||
| + | .col-xs-push-3 { | ||
| + | left: 25%; | ||
| + | } | ||
| + | .col-xs-push-2 { | ||
| + | left: 16.66666667%; | ||
| + | } | ||
| + | .col-xs-push-1 { | ||
| + | left: 8.33333333%; | ||
| + | } | ||
| + | .col-xs-push-0 { | ||
| + | left: auto; | ||
| + | } | ||
| + | .col-xs-offset-12 { | ||
| + | margin-left: 100%; | ||
| + | } | ||
| + | .col-xs-offset-11 { | ||
| + | margin-left: 91.66666667%; | ||
| + | } | ||
| + | .col-xs-offset-10 { | ||
| + | margin-left: 83.33333333%; | ||
| + | } | ||
| + | .col-xs-offset-9 { | ||
| + | margin-left: 75%; | ||
| + | } | ||
| + | .col-xs-offset-8 { | ||
| + | margin-left: 66.66666667%; | ||
| + | } | ||
| + | .col-xs-offset-7 { | ||
| + | margin-left: 58.33333333%; | ||
| + | } | ||
| + | .col-xs-offset-6 { | ||
| + | margin-left: 50%; | ||
| + | } | ||
| + | .col-xs-offset-5 { | ||
| + | margin-left: 41.66666667%; | ||
| + | } | ||
| + | .col-xs-offset-4 { | ||
| + | margin-left: 33.33333333%; | ||
| + | } | ||
| + | .col-xs-offset-3 { | ||
| + | margin-left: 25%; | ||
| + | } | ||
| + | .col-xs-offset-2 { | ||
| + | margin-left: 16.66666667%; | ||
| + | } | ||
| + | .col-xs-offset-1 { | ||
| + | margin-left: 8.33333333%; | ||
| + | } | ||
| + | .col-xs-offset-0 { | ||
| + | margin-left: 0%; | ||
| + | } | ||
| + | @media (min-width: 768px) { | ||
| + | .col-sm-1, | ||
| + | .col-sm-2, | ||
| + | .col-sm-3, | ||
| + | .col-sm-4, | ||
| + | .col-sm-5, | ||
| + | .col-sm-6, | ||
| + | .col-sm-7, | ||
| + | .col-sm-8, | ||
| + | .col-sm-9, | ||
| + | .col-sm-10, | ||
| + | .col-sm-11, | ||
| + | .col-sm-12 { | ||
| + | float: left; | ||
| + | } | ||
| + | .col-sm-12 { | ||
| + | width: 100%; | ||
| + | } | ||
| + | .col-sm-11 { | ||
| + | width: 91.66666667%; | ||
| + | } | ||
| + | .col-sm-10 { | ||
| + | width: 83.33333333%; | ||
| + | } | ||
| + | .col-sm-9 { | ||
| + | width: 75%; | ||
| + | } | ||
| + | .col-sm-8 { | ||
| + | width: 66.66666667%; | ||
| + | } | ||
| + | .col-sm-7 { | ||
| + | width: 58.33333333%; | ||
| + | } | ||
| + | .col-sm-6 { | ||
| + | width: 50%; | ||
| + | } | ||
| + | .col-sm-5 { | ||
| + | width: 41.66666667%; | ||
| + | } | ||
| + | .col-sm-4 { | ||
| + | width: 33.33333333%; | ||
| + | } | ||
| + | .col-sm-3 { | ||
| + | width: 25%; | ||
| + | } | ||
| + | .col-sm-2 { | ||
| + | width: 16.66666667%; | ||
| + | } | ||
| + | .col-sm-1 { | ||
| + | width: 8.33333333%; | ||
| + | } | ||
| + | .col-sm-pull-12 { | ||
| + | right: 100%; | ||
| + | } | ||
| + | .col-sm-pull-11 { | ||
| + | right: 91.66666667%; | ||
| + | } | ||
| + | .col-sm-pull-10 { | ||
| + | right: 83.33333333%; | ||
| + | } | ||
| + | .col-sm-pull-9 { | ||
| + | right: 75%; | ||
| + | } | ||
| + | .col-sm-pull-8 { | ||
| + | right: 66.66666667%; | ||
| + | } | ||
| + | .col-sm-pull-7 { | ||
| + | right: 58.33333333%; | ||
| + | } | ||
| + | .col-sm-pull-6 { | ||
| + | right: 50%; | ||
| + | } | ||
| + | .col-sm-pull-5 { | ||
| + | right: 41.66666667%; | ||
| + | } | ||
| + | .col-sm-pull-4 { | ||
| + | right: 33.33333333%; | ||
| + | } | ||
| + | .col-sm-pull-3 { | ||
| + | right: 25%; | ||
| + | } | ||
| + | .col-sm-pull-2 { | ||
| + | right: 16.66666667%; | ||
| + | } | ||
| + | .col-sm-pull-1 { | ||
| + | right: 8.33333333%; | ||
| + | } | ||
| + | .col-sm-pull-0 { | ||
| + | right: auto; | ||
| + | } | ||
| + | .col-sm-push-12 { | ||
| + | left: 100%; | ||
| + | } | ||
| + | .col-sm-push-11 { | ||
| + | left: 91.66666667%; | ||
| + | } | ||
| + | .col-sm-push-10 { | ||
| + | left: 83.33333333%; | ||
| + | } | ||
| + | .col-sm-push-9 { | ||
| + | left: 75%; | ||
| + | } | ||
| + | .col-sm-push-8 { | ||
| + | left: 66.66666667%; | ||
| + | } | ||
| + | .col-sm-push-7 { | ||
| + | left: 58.33333333%; | ||
| + | } | ||
| + | .col-sm-push-6 { | ||
| + | left: 50%; | ||
| + | } | ||
| + | .col-sm-push-5 { | ||
| + | left: 41.66666667%; | ||
| + | } | ||
| + | .col-sm-push-4 { | ||
| + | left: 33.33333333%; | ||
| + | } | ||
| + | .col-sm-push-3 { | ||
| + | left: 25%; | ||
| + | } | ||
| + | .col-sm-push-2 { | ||
| + | left: 16.66666667%; | ||
| + | } | ||
| + | .col-sm-push-1 { | ||
| + | left: 8.33333333%; | ||
| + | } | ||
| + | .col-sm-push-0 { | ||
| + | left: auto; | ||
| + | } | ||
| + | .col-sm-offset-12 { | ||
| + | margin-left: 100%; | ||
| + | } | ||
| + | .col-sm-offset-11 { | ||
| + | margin-left: 91.66666667%; | ||
| + | } | ||
| + | .col-sm-offset-10 { | ||
| + | margin-left: 83.33333333%; | ||
| + | } | ||
| + | .col-sm-offset-9 { | ||
| + | margin-left: 75%; | ||
| + | } | ||
| + | .col-sm-offset-8 { | ||
| + | margin-left: 66.66666667%; | ||
| + | } | ||
| + | .col-sm-offset-7 { | ||
| + | margin-left: 58.33333333%; | ||
| + | } | ||
| + | .col-sm-offset-6 { | ||
| + | margin-left: 50%; | ||
| + | } | ||
| + | .col-sm-offset-5 { | ||
| + | margin-left: 41.66666667%; | ||
| + | } | ||
| + | .col-sm-offset-4 { | ||
| + | margin-left: 33.33333333%; | ||
| + | } | ||
| + | .col-sm-offset-3 { | ||
| + | margin-left: 25%; | ||
| + | } | ||
| + | .col-sm-offset-2 { | ||
| + | margin-left: 16.66666667%; | ||
| + | } | ||
| + | .col-sm-offset-1 { | ||
| + | margin-left: 8.33333333%; | ||
| + | } | ||
| + | .col-sm-offset-0 { | ||
| + | margin-left: 0%; | ||
| + | } | ||
| + | } | ||
| + | @media (min-width: 992px) { | ||
| + | .col-md-1, | ||
| + | .col-md-2, | ||
| + | .col-md-3, | ||
| + | .col-md-4, | ||
| + | .col-md-5, | ||
| + | .col-md-6, | ||
| + | .col-md-7, | ||
| + | .col-md-8, | ||
| + | .col-md-9, | ||
| + | .col-md-10, | ||
| + | .col-md-11, | ||
| + | .col-md-12 { | ||
| + | float: left; | ||
| + | } | ||
| + | .col-md-12 { | ||
| + | width: 100%; | ||
| + | } | ||
| + | .col-md-11 { | ||
| + | width: 91.66666667%; | ||
| + | } | ||
| + | .col-md-10 { | ||
| + | width: 83.33333333%; | ||
| + | } | ||
| + | .col-md-9 { | ||
| + | width: 75%; | ||
| + | } | ||
| + | .col-md-8 { | ||
| + | width: 66.66666667%; | ||
| + | } | ||
| + | .col-md-7 { | ||
| + | width: 58.33333333%; | ||
| + | } | ||
| + | .col-md-6 { | ||
| + | width: 50%; | ||
| + | } | ||
| + | .col-md-5 { | ||
| + | width: 41.66666667%; | ||
| + | } | ||
| + | .col-md-4 { | ||
| + | width: 33.33333333%; | ||
| + | } | ||
| + | .col-md-3 { | ||
| + | width: 25%; | ||
| + | } | ||
| + | .col-md-2 { | ||
| + | width: 16.66666667%; | ||
| + | } | ||
| + | .col-md-1 { | ||
| + | width: 8.33333333%; | ||
| + | } | ||
| + | .col-md-pull-12 { | ||
| + | right: 100%; | ||
| + | } | ||
| + | .col-md-pull-11 { | ||
| + | right: 91.66666667%; | ||
| + | } | ||
| + | .col-md-pull-10 { | ||
| + | right: 83.33333333%; | ||
| + | } | ||
| + | .col-md-pull-9 { | ||
| + | right: 75%; | ||
| + | } | ||
| + | .col-md-pull-8 { | ||
| + | right: 66.66666667%; | ||
| + | } | ||
| + | .col-md-pull-7 { | ||
| + | right: 58.33333333%; | ||
| + | } | ||
| + | .col-md-pull-6 { | ||
| + | right: 50%; | ||
| + | } | ||
| + | .col-md-pull-5 { | ||
| + | right: 41.66666667%; | ||
| + | } | ||
| + | .col-md-pull-4 { | ||
| + | right: 33.33333333%; | ||
| + | } | ||
| + | .col-md-pull-3 { | ||
| + | right: 25%; | ||
| + | } | ||
| + | .col-md-pull-2 { | ||
| + | right: 16.66666667%; | ||
| + | } | ||
| + | .col-md-pull-1 { | ||
| + | right: 8.33333333%; | ||
| + | } | ||
| + | .col-md-pull-0 { | ||
| + | right: auto; | ||
| + | } | ||
| + | .col-md-push-12 { | ||
| + | left: 100%; | ||
| + | } | ||
| + | .col-md-push-11 { | ||
| + | left: 91.66666667%; | ||
| + | } | ||
| + | .col-md-push-10 { | ||
| + | left: 83.33333333%; | ||
| + | } | ||
| + | .col-md-push-9 { | ||
| + | left: 75%; | ||
| + | } | ||
| + | .col-md-push-8 { | ||
| + | left: 66.66666667%; | ||
| + | } | ||
| + | .col-md-push-7 { | ||
| + | left: 58.33333333%; | ||
| + | } | ||
| + | .col-md-push-6 { | ||
| + | left: 50%; | ||
| + | } | ||
| + | .col-md-push-5 { | ||
| + | left: 41.66666667%; | ||
| + | } | ||
| + | .col-md-push-4 { | ||
| + | left: 33.33333333%; | ||
| + | } | ||
| + | .col-md-push-3 { | ||
| + | left: 25%; | ||
| + | } | ||
| + | .col-md-push-2 { | ||
| + | left: 16.66666667%; | ||
| + | } | ||
| + | .col-md-push-1 { | ||
| + | left: 8.33333333%; | ||
| + | } | ||
| + | .col-md-push-0 { | ||
| + | left: auto; | ||
| + | } | ||
| + | .col-md-offset-12 { | ||
| + | margin-left: 100%; | ||
| + | } | ||
| + | .col-md-offset-11 { | ||
| + | margin-left: 91.66666667%; | ||
| + | } | ||
| + | .col-md-offset-10 { | ||
| + | margin-left: 83.33333333%; | ||
| + | } | ||
| + | .col-md-offset-9 { | ||
| + | margin-left: 75%; | ||
| + | } | ||
| + | .col-md-offset-8 { | ||
| + | margin-left: 66.66666667%; | ||
| + | } | ||
| + | .col-md-offset-7 { | ||
| + | margin-left: 58.33333333%; | ||
| + | } | ||
| + | .col-md-offset-6 { | ||
| + | margin-left: 50%; | ||
| + | } | ||
| + | .col-md-offset-5 { | ||
| + | margin-left: 41.66666667%; | ||
| + | } | ||
| + | .col-md-offset-4 { | ||
| + | margin-left: 33.33333333%; | ||
| + | } | ||
| + | .col-md-offset-3 { | ||
| + | margin-left: 25%; | ||
| + | } | ||
| + | .col-md-offset-2 { | ||
| + | margin-left: 16.66666667%; | ||
| + | } | ||
| + | .col-md-offset-1 { | ||
| + | margin-left: 8.33333333%; | ||
| + | } | ||
| + | .col-md-offset-0 { | ||
| + | margin-left: 0%; | ||
| + | } | ||
| + | } | ||
| + | @media (min-width: 1200px) { | ||
| + | .col-lg-1, | ||
| + | .col-lg-2, | ||
| + | .col-lg-3, | ||
| + | .col-lg-4, | ||
| + | .col-lg-5, | ||
| + | .col-lg-6, | ||
| + | .col-lg-7, | ||
| + | .col-lg-8, | ||
| + | .col-lg-9, | ||
| + | .col-lg-10, | ||
| + | .col-lg-11, | ||
| + | .col-lg-12 { | ||
| + | float: left; | ||
| + | } | ||
| + | .col-lg-12 { | ||
| + | width: 100%; | ||
| + | } | ||
| + | .col-lg-11 { | ||
| + | width: 91.66666667%; | ||
| + | } | ||
| + | .col-lg-10 { | ||
| + | width: 83.33333333%; | ||
| + | } | ||
| + | .col-lg-9 { | ||
| + | width: 75%; | ||
| + | } | ||
| + | .col-lg-8 { | ||
| + | width: 66.66666667%; | ||
| + | } | ||
| + | .col-lg-7 { | ||
| + | width: 58.33333333%; | ||
| + | } | ||
| + | .col-lg-6 { | ||
| + | width: 50%; | ||
| + | } | ||
| + | .col-lg-5 { | ||
| + | width: 41.66666667%; | ||
| + | } | ||
| + | .col-lg-4 { | ||
| + | width: 33.33333333%; | ||
| + | } | ||
| + | .col-lg-3 { | ||
| + | width: 25%; | ||
| + | } | ||
| + | .col-lg-2 { | ||
| + | width: 16.66666667%; | ||
| + | } | ||
| + | .col-lg-1 { | ||
| + | width: 8.33333333%; | ||
| + | } | ||
| + | .col-lg-pull-12 { | ||
| + | right: 100%; | ||
| + | } | ||
| + | .col-lg-pull-11 { | ||
| + | right: 91.66666667%; | ||
| + | } | ||
| + | .col-lg-pull-10 { | ||
| + | right: 83.33333333%; | ||
| + | } | ||
| + | .col-lg-pull-9 { | ||
| + | right: 75%; | ||
| + | } | ||
| + | .col-lg-pull-8 { | ||
| + | right: 66.66666667%; | ||
| + | } | ||
| + | .col-lg-pull-7 { | ||
| + | right: 58.33333333%; | ||
| + | } | ||
| + | .col-lg-pull-6 { | ||
| + | right: 50%; | ||
| + | } | ||
| + | .col-lg-pull-5 { | ||
| + | right: 41.66666667%; | ||
| + | } | ||
| + | .col-lg-pull-4 { | ||
| + | right: 33.33333333%; | ||
| + | } | ||
| + | .col-lg-pull-3 { | ||
| + | right: 25%; | ||
| + | } | ||
| + | .col-lg-pull-2 { | ||
| + | right: 16.66666667%; | ||
| + | } | ||
| + | .col-lg-pull-1 { | ||
| + | right: 8.33333333%; | ||
| + | } | ||
| + | .col-lg-pull-0 { | ||
| + | right: auto; | ||
| + | } | ||
| + | .col-lg-push-12 { | ||
| + | left: 100%; | ||
| + | } | ||
| + | .col-lg-push-11 { | ||
| + | left: 91.66666667%; | ||
| + | } | ||
| + | .col-lg-push-10 { | ||
| + | left: 83.33333333%; | ||
| + | } | ||
| + | .col-lg-push-9 { | ||
| + | left: 75%; | ||
| + | } | ||
| + | .col-lg-push-8 { | ||
| + | left: 66.66666667%; | ||
| + | } | ||
| + | .col-lg-push-7 { | ||
| + | left: 58.33333333%; | ||
| + | } | ||
| + | .col-lg-push-6 { | ||
| + | left: 50%; | ||
| + | } | ||
| + | .col-lg-push-5 { | ||
| + | left: 41.66666667%; | ||
| + | } | ||
| + | .col-lg-push-4 { | ||
| + | left: 33.33333333%; | ||
| + | } | ||
| + | .col-lg-push-3 { | ||
| + | left: 25%; | ||
| + | } | ||
| + | .col-lg-push-2 { | ||
| + | left: 16.66666667%; | ||
| + | } | ||
| + | .col-lg-push-1 { | ||
| + | left: 8.33333333%; | ||
| + | } | ||
| + | .col-lg-push-0 { | ||
| + | left: auto; | ||
| + | } | ||
| + | .col-lg-offset-12 { | ||
| + | margin-left: 100%; | ||
| + | } | ||
| + | .col-lg-offset-11 { | ||
| + | margin-left: 91.66666667%; | ||
| + | } | ||
| + | .col-lg-offset-10 { | ||
| + | margin-left: 83.33333333%; | ||
| + | } | ||
| + | .col-lg-offset-9 { | ||
| + | margin-left: 75%; | ||
| + | } | ||
| + | .col-lg-offset-8 { | ||
| + | margin-left: 66.66666667%; | ||
| + | } | ||
| + | .col-lg-offset-7 { | ||
| + | margin-left: 58.33333333%; | ||
| + | } | ||
| + | .col-lg-offset-6 { | ||
| + | margin-left: 50%; | ||
| + | } | ||
| + | .col-lg-offset-5 { | ||
| + | margin-left: 41.66666667%; | ||
| + | } | ||
| + | .col-lg-offset-4 { | ||
| + | margin-left: 33.33333333%; | ||
| + | } | ||
| + | .col-lg-offset-3 { | ||
| + | margin-left: 25%; | ||
| + | } | ||
| + | .col-lg-offset-2 { | ||
| + | margin-left: 16.66666667%; | ||
| + | } | ||
| + | .col-lg-offset-1 { | ||
| + | margin-left: 8.33333333%; | ||
| + | } | ||
| + | .col-lg-offset-0 { | ||
| + | margin-left: 0%; | ||
| + | } | ||
| + | } | ||
| + | table { | ||
| + | background-color: transparent; | ||
| + | } | ||
| + | table col[class*="col-"] { | ||
| + | position: static; | ||
| + | display: table-column; | ||
| + | float: none; | ||
| + | } | ||
| + | table td[class*="col-"], | ||
| + | table th[class*="col-"] { | ||
| + | position: static; | ||
| + | display: table-cell; | ||
| + | float: none; | ||
| + | } | ||
| + | caption { | ||
| + | padding-top: 8px; | ||
| + | padding-bottom: 8px; | ||
| + | color: #777777; | ||
| + | text-align: left; | ||
| + | } | ||
| + | th { | ||
| + | text-align: left; | ||
| + | } | ||
| + | .table { | ||
| + | width: 100%; | ||
| + | max-width: 100%; | ||
| + | margin-bottom: 20px; | ||
| + | } | ||
| + | .table > thead > tr > th, | ||
| + | .table > tbody > tr > th, | ||
| + | .table > tfoot > tr > th, | ||
| + | .table > thead > tr > td, | ||
| + | .table > tbody > tr > td, | ||
| + | .table > tfoot > tr > td { | ||
| + | padding: 8px; | ||
| + | line-height: 1.42857143; | ||
| + | vertical-align: top; | ||
| + | border-top: 1px solid #ddd; | ||
| + | } | ||
| + | .table > thead > tr > th { | ||
| + | vertical-align: bottom; | ||
| + | border-bottom: 2px solid #ddd; | ||
| + | } | ||
| + | .table > caption + thead > tr:first-child > th, | ||
| + | .table > colgroup + thead > tr:first-child > th, | ||
| + | .table > thead:first-child > tr:first-child > th, | ||
| + | .table > caption + thead > tr:first-child > td, | ||
| + | .table > colgroup + thead > tr:first-child > td, | ||
| + | .table > thead:first-child > tr:first-child > td { | ||
| + | border-top: 0; | ||
| + | } | ||
| + | .table > tbody + tbody { | ||
| + | border-top: 2px solid #ddd; | ||
| + | } | ||
| + | .table .table { | ||
| + | background-color: #fff; | ||
| + | } | ||
| + | .table-condensed > thead > tr > th, | ||
| + | .table-condensed > tbody > tr > th, | ||
| + | .table-condensed > tfoot > tr > th, | ||
| + | .table-condensed > thead > tr > td, | ||
| + | .table-condensed > tbody > tr > td, | ||
| + | .table-condensed > tfoot > tr > td { | ||
| + | padding: 5px; | ||
| + | } | ||
| + | .table-bordered { | ||
| + | border: 1px solid #ddd; | ||
| + | } | ||
| + | .table-bordered > thead > tr > th, | ||
| + | .table-bordered > tbody > tr > th, | ||
| + | .table-bordered > tfoot > tr > th, | ||
| + | .table-bordered > thead > tr > td, | ||
| + | .table-bordered > tbody > tr > td, | ||
| + | .table-bordered > tfoot > tr > td { | ||
| + | border: 1px solid #ddd; | ||
| + | } | ||
| + | .table-bordered > thead > tr > th, | ||
| + | .table-bordered > thead > tr > td { | ||
| + | border-bottom-width: 2px; | ||
| + | } | ||
| + | .table-striped > tbody > tr:nth-of-type(odd) { | ||
| + | background-color: #f9f9f9; | ||
| + | } | ||
| + | .table-hover > tbody > tr:hover { | ||
| + | background-color: #f5f5f5; | ||
| + | } | ||
| + | .table > thead > tr > td.active, | ||
| + | .table > tbody > tr > td.active, | ||
| + | .table > tfoot > tr > td.active, | ||
| + | .table > thead > tr > th.active, | ||
| + | .table > tbody > tr > th.active, | ||
| + | .table > tfoot > tr > th.active, | ||
| + | .table > thead > tr.active > td, | ||
| + | .table > tbody > tr.active > td, | ||
| + | .table > tfoot > tr.active > td, | ||
| + | .table > thead > tr.active > th, | ||
| + | .table > tbody > tr.active > th, | ||
| + | .table > tfoot > tr.active > th { | ||
| + | background-color: #f5f5f5; | ||
| + | } | ||
| + | .table-hover > tbody > tr > td.active:hover, | ||
| + | .table-hover > tbody > tr > th.active:hover, | ||
| + | .table-hover > tbody > tr.active:hover > td, | ||
| + | .table-hover > tbody > tr:hover > .active, | ||
| + | .table-hover > tbody > tr.active:hover > th { | ||
| + | background-color: #e8e8e8; | ||
| + | } | ||
| + | .table > thead > tr > td.success, | ||
| + | .table > tbody > tr > td.success, | ||
| + | .table > tfoot > tr > td.success, | ||
| + | .table > thead > tr > th.success, | ||
| + | .table > tbody > tr > th.success, | ||
| + | .table > tfoot > tr > th.success, | ||
| + | .table > thead > tr.success > td, | ||
| + | .table > tbody > tr.success > td, | ||
| + | .table > tfoot > tr.success > td, | ||
| + | .table > thead > tr.success > th, | ||
| + | .table > tbody > tr.success > th, | ||
| + | .table > tfoot > tr.success > th { | ||
| + | background-color: #dff0d8; | ||
| + | } | ||
| + | .table-hover > tbody > tr > td.success:hover, | ||
| + | .table-hover > tbody > tr > th.success:hover, | ||
| + | .table-hover > tbody > tr.success:hover > td, | ||
| + | .table-hover > tbody > tr:hover > .success, | ||
| + | .table-hover > tbody > tr.success:hover > th { | ||
| + | background-color: #d0e9c6; | ||
| + | } | ||
| + | .table > thead > tr > td.info, | ||
| + | .table > tbody > tr > td.info, | ||
| + | .table > tfoot > tr > td.info, | ||
| + | .table > thead > tr > th.info, | ||
| + | .table > tbody > tr > th.info, | ||
| + | .table > tfoot > tr > th.info, | ||
| + | .table > thead > tr.info > td, | ||
| + | .table > tbody > tr.info > td, | ||
| + | .table > tfoot > tr.info > td, | ||
| + | .table > thead > tr.info > th, | ||
| + | .table > tbody > tr.info > th, | ||
| + | .table > tfoot > tr.info > th { | ||
| + | background-color: #d9edf7; | ||
| + | } | ||
| + | .table-hover > tbody > tr > td.info:hover, | ||
| + | .table-hover > tbody > tr > th.info:hover, | ||
| + | .table-hover > tbody > tr.info:hover > td, | ||
| + | .table-hover > tbody > tr:hover > .info, | ||
| + | .table-hover > tbody > tr.info:hover > th { | ||
| + | background-color: #c4e3f3; | ||
| + | } | ||
| + | .table > thead > tr > td.warning, | ||
| + | .table > tbody > tr > td.warning, | ||
| + | .table > tfoot > tr > td.warning, | ||
| + | .table > thead > tr > th.warning, | ||
| + | .table > tbody > tr > th.warning, | ||
| + | .table > tfoot > tr > th.warning, | ||
| + | .table > thead > tr.warning > td, | ||
| + | .table > tbody > tr.warning > td, | ||
| + | .table > tfoot > tr.warning > td, | ||
| + | .table > thead > tr.warning > th, | ||
| + | .table > tbody > tr.warning > th, | ||
| + | .table > tfoot > tr.warning > th { | ||
| + | background-color: #fcf8e3; | ||
| + | } | ||
| + | .table-hover > tbody > tr > td.warning:hover, | ||
| + | .table-hover > tbody > tr > th.warning:hover, | ||
| + | .table-hover > tbody > tr.warning:hover > td, | ||
| + | .table-hover > tbody > tr:hover > .warning, | ||
| + | .table-hover > tbody > tr.warning:hover > th { | ||
| + | background-color: #faf2cc; | ||
| + | } | ||
| + | .table > thead > tr > td.danger, | ||
| + | .table > tbody > tr > td.danger, | ||
| + | .table > tfoot > tr > td.danger, | ||
| + | .table > thead > tr > th.danger, | ||
| + | .table > tbody > tr > th.danger, | ||
| + | .table > tfoot > tr > th.danger, | ||
| + | .table > thead > tr.danger > td, | ||
| + | .table > tbody > tr.danger > td, | ||
| + | .table > tfoot > tr.danger > td, | ||
| + | .table > thead > tr.danger > th, | ||
| + | .table > tbody > tr.danger > th, | ||
| + | .table > tfoot > tr.danger > th { | ||
| + | background-color: #f2dede; | ||
| + | } | ||
| + | .table-hover > tbody > tr > td.danger:hover, | ||
| + | .table-hover > tbody > tr > th.danger:hover, | ||
| + | .table-hover > tbody > tr.danger:hover > td, | ||
| + | .table-hover > tbody > tr:hover > .danger, | ||
| + | .table-hover > tbody > tr.danger:hover > th { | ||
| + | background-color: #ebcccc; | ||
| + | } | ||
| + | .table-responsive { | ||
| + | min-height: 0.01%; | ||
| + | overflow-x: auto; | ||
| + | } | ||
| + | @media screen and (max-width: 767px) { | ||
| + | .table-responsive { | ||
| + | width: 100%; | ||
| + | margin-bottom: 15px; | ||
| + | overflow-y: hidden; | ||
| + | -ms-overflow-style: -ms-autohiding-scrollbar; | ||
| + | border: 1px solid #ddd; | ||
| + | } | ||
| + | .table-responsive > .table { | ||
| + | margin-bottom: 0; | ||
| + | } | ||
| + | .table-responsive > .table > thead > tr > th, | ||
| + | .table-responsive > .table > tbody > tr > th, | ||
| + | .table-responsive > .table > tfoot > tr > th, | ||
| + | .table-responsive > .table > thead > tr > td, | ||
| + | .table-responsive > .table > tbody > tr > td, | ||
| + | .table-responsive > .table > tfoot > tr > td { | ||
| + | white-space: nowrap; | ||
| + | } | ||
| + | .table-responsive > .table-bordered { | ||
| + | border: 0; | ||
| + | } | ||
| + | .table-responsive > .table-bordered > thead > tr > th:first-child, | ||
| + | .table-responsive > .table-bordered > tbody > tr > th:first-child, | ||
| + | .table-responsive > .table-bordered > tfoot > tr > th:first-child, | ||
| + | .table-responsive > .table-bordered > thead > tr > td:first-child, | ||
| + | .table-responsive > .table-bordered > tbody > tr > td:first-child, | ||
| + | .table-responsive > .table-bordered > tfoot > tr > td:first-child { | ||
| + | border-left: 0; | ||
| + | } | ||
| + | .table-responsive > .table-bordered > thead > tr > th:last-child, | ||
| + | .table-responsive > .table-bordered > tbody > tr > th:last-child, | ||
| + | .table-responsive > .table-bordered > tfoot > tr > th:last-child, | ||
| + | .table-responsive > .table-bordered > thead > tr > td:last-child, | ||
| + | .table-responsive > .table-bordered > tbody > tr > td:last-child, | ||
| + | .table-responsive > .table-bordered > tfoot > tr > td:last-child { | ||
| + | border-right: 0; | ||
| + | } | ||
| + | .table-responsive > .table-bordered > tbody > tr:last-child > th, | ||
| + | .table-responsive > .table-bordered > tfoot > tr:last-child > th, | ||
| + | .table-responsive > .table-bordered > tbody > tr:last-child > td, | ||
| + | .table-responsive > .table-bordered > tfoot > tr:last-child > td { | ||
| + | border-bottom: 0; | ||
| + | } | ||
| + | } | ||
| + | fieldset { | ||
| + | min-width: 0; | ||
| + | padding: 0; | ||
| + | margin: 0; | ||
| + | border: 0; | ||
| + | } | ||
| + | legend { | ||
| + | display: block; | ||
| + | width: 100%; | ||
| + | padding: 0; | ||
| + | margin-bottom: 20px; | ||
| + | font-size: 21px; | ||
| + | line-height: inherit; | ||
| + | color: #333333; | ||
| + | border: 0; | ||
| + | border-bottom: 1px solid #e5e5e5; | ||
| + | } | ||
| + | label { | ||
| + | display: inline-block; | ||
| + | max-width: 100%; | ||
| + | margin-bottom: 5px; | ||
| + | font-weight: 700; | ||
| + | } | ||
| + | input[type="search"] { | ||
| + | -webkit-box-sizing: border-box; | ||
| + | -moz-box-sizing: border-box; | ||
| + | box-sizing: border-box; | ||
| + | -webkit-appearance: none; | ||
| + | -moz-appearance: none; | ||
| + | appearance: none; | ||
| + | } | ||
| + | input[type="radio"], | ||
| + | input[type="checkbox"] { | ||
| + | margin: 4px 0 0; | ||
| + | margin-top: 1px \9; | ||
| + | line-height: normal; | ||
| + | } | ||
| + | input[type="radio"][disabled], | ||
| + | input[type="checkbox"][disabled], | ||
| + | input[type="radio"].disabled, | ||
| + | input[type="checkbox"].disabled, | ||
| + | fieldset[disabled] input[type="radio"], | ||
| + | fieldset[disabled] input[type="checkbox"] { | ||
| + | cursor: not-allowed; | ||
| + | } | ||
| + | input[type="file"] { | ||
| + | display: block; | ||
| + | } | ||
| + | input[type="range"] { | ||
| + | display: block; | ||
| + | width: 100%; | ||
| + | } | ||
| + | select[multiple], | ||
| + | select[size] { | ||
| + | height: auto; | ||
| + | } | ||
| + | input[type="file"]:focus, | ||
| + | input[type="radio"]:focus, | ||
| + | input[type="checkbox"]:focus { | ||
| + | outline: 5px auto -webkit-focus-ring-color; | ||
| + | outline-offset: -2px; | ||
| + | } | ||
| + | output { | ||
| + | display: block; | ||
| + | padding-top: 7px; | ||
| + | font-size: 14px; | ||
| + | line-height: 1.42857143; | ||
| + | color: #555555; | ||
| + | } | ||
| + | .form-control { | ||
| + | display: block; | ||
| + | width: 100%; | ||
| + | height: 34px; | ||
| + | padding: 6px 12px; | ||
| + | font-size: 14px; | ||
| + | line-height: 1.42857143; | ||
| + | color: #555555; | ||
| + | background-color: #fff; | ||
| + | background-image: none; | ||
| + | border: 1px solid #ccc; | ||
| + | border-radius: 4px; | ||
| + | -webkit-box-shadow: inset 0 1px 1px rgba(0, 0, 0, 0.075); | ||
| + | box-shadow: inset 0 1px 1px rgba(0, 0, 0, 0.075); | ||
| + | -webkit-transition: border-color ease-in-out .15s, box-shadow ease-in-out .15s; | ||
| + | -o-transition: border-color ease-in-out .15s, box-shadow ease-in-out .15s; | ||
| + | -webkit-transition: border-color ease-in-out .15s, -webkit-box-shadow ease-in-out .15s; | ||
| + | transition: border-color ease-in-out .15s, -webkit-box-shadow ease-in-out .15s; | ||
| + | transition: border-color ease-in-out .15s, box-shadow ease-in-out .15s; | ||
| + | transition: border-color ease-in-out .15s, box-shadow ease-in-out .15s, -webkit-box-shadow ease-in-out .15s; | ||
| + | } | ||
| + | .form-control:focus { | ||
| + | border-color: #66afe9; | ||
| + | outline: 0; | ||
| + | -webkit-box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075), 0 0 8px rgba(102, 175, 233, 0.6); | ||
| + | box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075), 0 0 8px rgba(102, 175, 233, 0.6); | ||
| + | } | ||
| + | .form-control::-moz-placeholder { | ||
| + | color: #999; | ||
| + | opacity: 1; | ||
| + | } | ||
| + | .form-control:-ms-input-placeholder { | ||
| + | color: #999; | ||
| + | } | ||
| + | .form-control::-webkit-input-placeholder { | ||
| + | color: #999; | ||
| + | } | ||
| + | .form-control::-ms-expand { | ||
| + | background-color: transparent; | ||
| + | border: 0; | ||
| + | } | ||
| + | .form-control[disabled], | ||
| + | .form-control[readonly], | ||
| + | fieldset[disabled] .form-control { | ||
| + | background-color: #eeeeee; | ||
| + | opacity: 1; | ||
| + | } | ||
| + | .form-control[disabled], | ||
| + | fieldset[disabled] .form-control { | ||
| + | cursor: not-allowed; | ||
| + | } | ||
| + | textarea.form-control { | ||
| + | height: auto; | ||
| + | } | ||
| + | @media screen and (-webkit-min-device-pixel-ratio: 0) { | ||
| + | input[type="date"].form-control, | ||
| + | input[type="time"].form-control, | ||
| + | input[type="datetime-local"].form-control, | ||
| + | input[type="month"].form-control { | ||
| + | line-height: 34px; | ||
| + | } | ||
| + | input[type="date"].input-sm, | ||
| + | input[type="time"].input-sm, | ||
| + | input[type="datetime-local"].input-sm, | ||
| + | input[type="month"].input-sm, | ||
| + | .input-group-sm input[type="date"], | ||
| + | .input-group-sm input[type="time"], | ||
| + | .input-group-sm input[type="datetime-local"], | ||
| + | .input-group-sm input[type="month"] { | ||
| + | line-height: 30px; | ||
| + | } | ||
| + | input[type="date"].input-lg, | ||
| + | input[type="time"].input-lg, | ||
| + | input[type="datetime-local"].input-lg, | ||
| + | input[type="month"].input-lg, | ||
| + | .input-group-lg input[type="date"], | ||
| + | .input-group-lg input[type="time"], | ||
| + | .input-group-lg input[type="datetime-local"], | ||
| + | .input-group-lg input[type="month"] { | ||
| + | line-height: 46px; | ||
| + | } | ||
| + | } | ||
| + | .form-group { | ||
| + | margin-bottom: 15px; | ||
| + | } | ||
| + | .radio, | ||
| + | .checkbox { | ||
| + | position: relative; | ||
| + | display: block; | ||
| + | margin-top: 10px; | ||
| + | margin-bottom: 10px; | ||
| + | } | ||
| + | .radio.disabled label, | ||
| + | .checkbox.disabled label, | ||
| + | fieldset[disabled] .radio label, | ||
| + | fieldset[disabled] .checkbox label { | ||
| + | cursor: not-allowed; | ||
| + | } | ||
| + | .radio label, | ||
| + | .checkbox label { | ||
| + | min-height: 20px; | ||
| + | padding-left: 20px; | ||
| + | margin-bottom: 0; | ||
| + | font-weight: 400; | ||
| + | cursor: pointer; | ||
| + | } | ||
| + | .radio input[type="radio"], | ||
| + | .radio-inline input[type="radio"], | ||
| + | .checkbox input[type="checkbox"], | ||
| + | .checkbox-inline input[type="checkbox"] { | ||
| + | position: absolute; | ||
| + | margin-top: 4px \9; | ||
| + | margin-left: -20px; | ||
| + | } | ||
| + | .radio + .radio, | ||
| + | .checkbox + .checkbox { | ||
| + | margin-top: -5px; | ||
| + | } | ||
| + | .radio-inline, | ||
| + | .checkbox-inline { | ||
| + | position: relative; | ||
| + | display: inline-block; | ||
| + | padding-left: 20px; | ||
| + | margin-bottom: 0; | ||
| + | font-weight: 400; | ||
| + | vertical-align: middle; | ||
| + | cursor: pointer; | ||
| + | } | ||
| + | .radio-inline.disabled, | ||
| + | .checkbox-inline.disabled, | ||
| + | fieldset[disabled] .radio-inline, | ||
| + | fieldset[disabled] .checkbox-inline { | ||
| + | cursor: not-allowed; | ||
| + | } | ||
| + | .radio-inline + .radio-inline, | ||
| + | .checkbox-inline + .checkbox-inline { | ||
| + | margin-top: 0; | ||
| + | margin-left: 10px; | ||
| + | } | ||
| + | .form-control-static { | ||
| + | min-height: 34px; | ||
| + | padding-top: 7px; | ||
| + | padding-bottom: 7px; | ||
| + | margin-bottom: 0; | ||
| + | } | ||
| + | .form-control-static.input-lg, | ||
| + | .form-control-static.input-sm { | ||
| + | padding-right: 0; | ||
| + | padding-left: 0; | ||
| + | } | ||
| + | .input-sm { | ||
| + | height: 30px; | ||
| + | padding: 5px 10px; | ||
| + | font-size: 12px; | ||
| + | line-height: 1.5; | ||
| + | border-radius: 3px; | ||
| + | } | ||
| + | select.input-sm { | ||
| + | height: 30px; | ||
| + | line-height: 30px; | ||
| + | } | ||
| + | textarea.input-sm, | ||
| + | select[multiple].input-sm { | ||
| + | height: auto; | ||
| + | } | ||
| + | .form-group-sm .form-control { | ||
| + | height: 30px; | ||
| + | padding: 5px 10px; | ||
| + | font-size: 12px; | ||
| + | line-height: 1.5; | ||
| + | border-radius: 3px; | ||
| + | } | ||
| + | .form-group-sm select.form-control { | ||
| + | height: 30px; | ||
| + | line-height: 30px; | ||
| + | } | ||
| + | .form-group-sm textarea.form-control, | ||
| + | .form-group-sm select[multiple].form-control { | ||
| + | height: auto; | ||
| + | } | ||
| + | .form-group-sm .form-control-static { | ||
| + | height: 30px; | ||
| + | min-height: 32px; | ||
| + | padding: 6px 10px; | ||
| + | font-size: 12px; | ||
| + | line-height: 1.5; | ||
| + | } | ||
| + | .input-lg { | ||
| + | height: 46px; | ||
| + | padding: 10px 16px; | ||
| + | font-size: 18px; | ||
| + | line-height: 1.3333333; | ||
| + | border-radius: 6px; | ||
| + | } | ||
| + | select.input-lg { | ||
| + | height: 46px; | ||
| + | line-height: 46px; | ||
| + | } | ||
| + | textarea.input-lg, | ||
| + | select[multiple].input-lg { | ||
| + | height: auto; | ||
| + | } | ||
| + | .form-group-lg .form-control { | ||
| + | height: 46px; | ||
| + | padding: 10px 16px; | ||
| + | font-size: 18px; | ||
| + | line-height: 1.3333333; | ||
| + | border-radius: 6px; | ||
| + | } | ||
| + | .form-group-lg select.form-control { | ||
| + | height: 46px; | ||
| + | line-height: 46px; | ||
| + | } | ||
| + | .form-group-lg textarea.form-control, | ||
| + | .form-group-lg select[multiple].form-control { | ||
| + | height: auto; | ||
| + | } | ||
| + | .form-group-lg .form-control-static { | ||
| + | height: 46px; | ||
| + | min-height: 38px; | ||
| + | padding: 11px 16px; | ||
| + | font-size: 18px; | ||
| + | line-height: 1.3333333; | ||
| + | } | ||
| + | .has-feedback { | ||
| + | position: relative; | ||
| + | } | ||
| + | .has-feedback .form-control { | ||
| + | padding-right: 42.5px; | ||
| + | } | ||
| + | .form-control-feedback { | ||
| + | position: absolute; | ||
| + | top: 0; | ||
| + | right: 0; | ||
| + | z-index: 2; | ||
| + | display: block; | ||
| + | width: 34px; | ||
| + | height: 34px; | ||
| + | line-height: 34px; | ||
| + | text-align: center; | ||
| + | pointer-events: none; | ||
| + | } | ||
| + | .input-lg + .form-control-feedback, | ||
| + | .input-group-lg + .form-control-feedback, | ||
| + | .form-group-lg .form-control + .form-control-feedback { | ||
| + | width: 46px; | ||
| + | height: 46px; | ||
| + | line-height: 46px; | ||
| + | } | ||
| + | .input-sm + .form-control-feedback, | ||
| + | .input-group-sm + .form-control-feedback, | ||
| + | .form-group-sm .form-control + .form-control-feedback { | ||
| + | width: 30px; | ||
| + | height: 30px; | ||
| + | line-height: 30px; | ||
| + | } | ||
| + | .has-success .help-block, | ||
| + | .has-success .control-label, | ||
| + | .has-success .radio, | ||
| + | .has-success .checkbox, | ||
| + | .has-success .radio-inline, | ||
| + | .has-success .checkbox-inline, | ||
| + | .has-success.radio label, | ||
| + | .has-success.checkbox label, | ||
| + | .has-success.radio-inline label, | ||
| + | .has-success.checkbox-inline label { | ||
| + | color: #3c763d; | ||
| + | } | ||
| + | .has-success .form-control { | ||
| + | border-color: #3c763d; | ||
| + | -webkit-box-shadow: inset 0 1px 1px rgba(0, 0, 0, 0.075); | ||
| + | box-shadow: inset 0 1px 1px rgba(0, 0, 0, 0.075); | ||
| + | } | ||
| + | .has-success .form-control:focus { | ||
| + | border-color: #2b542c; | ||
| + | -webkit-box-shadow: inset 0 1px 1px rgba(0, 0, 0, 0.075), 0 0 6px #67b168; | ||
| + | box-shadow: inset 0 1px 1px rgba(0, 0, 0, 0.075), 0 0 6px #67b168; | ||
| + | } | ||
| + | .has-success .input-group-addon { | ||
| + | color: #3c763d; | ||
| + | background-color: #dff0d8; | ||
| + | border-color: #3c763d; | ||
| + | } | ||
| + | .has-success .form-control-feedback { | ||
| + | color: #3c763d; | ||
| + | } | ||
| + | .has-warning .help-block, | ||
| + | .has-warning .control-label, | ||
| + | .has-warning .radio, | ||
| + | .has-warning .checkbox, | ||
| + | .has-warning .radio-inline, | ||
| + | .has-warning .checkbox-inline, | ||
| + | .has-warning.radio label, | ||
| + | .has-warning.checkbox label, | ||
| + | .has-warning.radio-inline label, | ||
| + | .has-warning.checkbox-inline label { | ||
| + | color: #8a6d3b; | ||
| + | } | ||
| + | .has-warning .form-control { | ||
| + | border-color: #8a6d3b; | ||
| + | -webkit-box-shadow: inset 0 1px 1px rgba(0, 0, 0, 0.075); | ||
| + | box-shadow: inset 0 1px 1px rgba(0, 0, 0, 0.075); | ||
| + | } | ||
| + | .has-warning .form-control:focus { | ||
| + | border-color: #66512c; | ||
| + | -webkit-box-shadow: inset 0 1px 1px rgba(0, 0, 0, 0.075), 0 0 6px #c0a16b; | ||
| + | box-shadow: inset 0 1px 1px rgba(0, 0, 0, 0.075), 0 0 6px #c0a16b; | ||
| + | } | ||
| + | .has-warning .input-group-addon { | ||
| + | color: #8a6d3b; | ||
| + | background-color: #fcf8e3; | ||
| + | border-color: #8a6d3b; | ||
| + | } | ||
| + | .has-warning .form-control-feedback { | ||
| + | color: #8a6d3b; | ||
| + | } | ||
| + | .has-error .help-block, | ||
| + | .has-error .control-label, | ||
| + | .has-error .radio, | ||
| + | .has-error .checkbox, | ||
| + | .has-error .radio-inline, | ||
| + | .has-error .checkbox-inline, | ||
| + | .has-error.radio label, | ||
| + | .has-error.checkbox label, | ||
| + | .has-error.radio-inline label, | ||
| + | .has-error.checkbox-inline label { | ||
| + | color: #a94442; | ||
| + | } | ||
| + | .has-error .form-control { | ||
| + | border-color: #a94442; | ||
| + | -webkit-box-shadow: inset 0 1px 1px rgba(0, 0, 0, 0.075); | ||
| + | box-shadow: inset 0 1px 1px rgba(0, 0, 0, 0.075); | ||
| + | } | ||
| + | .has-error .form-control:focus { | ||
| + | border-color: #843534; | ||
| + | -webkit-box-shadow: inset 0 1px 1px rgba(0, 0, 0, 0.075), 0 0 6px #ce8483; | ||
| + | box-shadow: inset 0 1px 1px rgba(0, 0, 0, 0.075), 0 0 6px #ce8483; | ||
| + | } | ||
| + | .has-error .input-group-addon { | ||
| + | color: #a94442; | ||
| + | background-color: #f2dede; | ||
| + | border-color: #a94442; | ||
| + | } | ||
| + | .has-error .form-control-feedback { | ||
| + | color: #a94442; | ||
| + | } | ||
| + | .has-feedback label ~ .form-control-feedback { | ||
| + | top: 25px; | ||
| + | } | ||
| + | .has-feedback label.sr-only ~ .form-control-feedback { | ||
| + | top: 0; | ||
| + | } | ||
| + | .help-block { | ||
| + | display: block; | ||
| + | margin-top: 5px; | ||
| + | margin-bottom: 10px; | ||
| + | color: #737373; | ||
| + | } | ||
| + | @media (min-width: 768px) { | ||
| + | .form-inline .form-group { | ||
| + | display: inline-block; | ||
| + | margin-bottom: 0; | ||
| + | vertical-align: middle; | ||
| + | } | ||
| + | .form-inline .form-control { | ||
| + | display: inline-block; | ||
| + | width: auto; | ||
| + | vertical-align: middle; | ||
| + | } | ||
| + | .form-inline .form-control-static { | ||
| + | display: inline-block; | ||
| + | } | ||
| + | .form-inline .input-group { | ||
| + | display: inline-table; | ||
| + | vertical-align: middle; | ||
| + | } | ||
| + | .form-inline .input-group .input-group-addon, | ||
| + | .form-inline .input-group .input-group-btn, | ||
| + | .form-inline .input-group .form-control { | ||
| + | width: auto; | ||
| + | } | ||
| + | .form-inline .input-group > .form-control { | ||
| + | width: 100%; | ||
| + | } | ||
| + | .form-inline .control-label { | ||
| + | margin-bottom: 0; | ||
| + | vertical-align: middle; | ||
| + | } | ||
| + | .form-inline .radio, | ||
| + | .form-inline .checkbox { | ||
| + | display: inline-block; | ||
| + | margin-top: 0; | ||
| + | margin-bottom: 0; | ||
| + | vertical-align: middle; | ||
| + | } | ||
| + | .form-inline .radio label, | ||
| + | .form-inline .checkbox label { | ||
| + | padding-left: 0; | ||
| + | } | ||
| + | .form-inline .radio input[type="radio"], | ||
| + | .form-inline .checkbox input[type="checkbox"] { | ||
| + | position: relative; | ||
| + | margin-left: 0; | ||
| + | } | ||
| + | .form-inline .has-feedback .form-control-feedback { | ||
| + | top: 0; | ||
| + | } | ||
| + | } | ||
| + | .form-horizontal .radio, | ||
| + | .form-horizontal .checkbox, | ||
| + | .form-horizontal .radio-inline, | ||
| + | .form-horizontal .checkbox-inline { | ||
| + | padding-top: 7px; | ||
| + | margin-top: 0; | ||
| + | margin-bottom: 0; | ||
| + | } | ||
| + | .form-horizontal .radio, | ||
| + | .form-horizontal .checkbox { | ||
| + | min-height: 27px; | ||
| + | } | ||
| + | .form-horizontal .form-group { | ||
| + | margin-right: -15px; | ||
| + | margin-left: -15px; | ||
| + | } | ||
| + | @media (min-width: 768px) { | ||
| + | .form-horizontal .control-label { | ||
| + | padding-top: 7px; | ||
| + | margin-bottom: 0; | ||
| + | text-align: right; | ||
| + | } | ||
| + | } | ||
| + | .form-horizontal .has-feedback .form-control-feedback { | ||
| + | right: 15px; | ||
| + | } | ||
| + | @media (min-width: 768px) { | ||
| + | .form-horizontal .form-group-lg .control-label { | ||
| + | padding-top: 11px; | ||
| + | font-size: 18px; | ||
| + | } | ||
| + | } | ||
| + | @media (min-width: 768px) { | ||
| + | .form-horizontal .form-group-sm .control-label { | ||
| + | padding-top: 6px; | ||
| + | font-size: 12px; | ||
| + | } | ||
| + | } | ||
| + | .btn { | ||
| + | display: inline-block; | ||
| + | margin-bottom: 0; | ||
| + | font-weight: normal; | ||
| + | text-align: center; | ||
| + | white-space: nowrap; | ||
| + | vertical-align: middle; | ||
| + | -ms-touch-action: manipulation; | ||
| + | touch-action: manipulation; | ||
| + | cursor: pointer; | ||
| + | background-image: none; | ||
| + | border: 1px solid transparent; | ||
| + | padding: 6px 12px; | ||
| + | font-size: 14px; | ||
| + | line-height: 1.42857143; | ||
| + | border-radius: 4px; | ||
| + | -webkit-user-select: none; | ||
| + | -moz-user-select: none; | ||
| + | -ms-user-select: none; | ||
| + | user-select: none; | ||
| + | } | ||
| + | .btn:focus, | ||
| + | .btn:active:focus, | ||
| + | .btn.active:focus, | ||
| + | .btn.focus, | ||
| + | .btn:active.focus, | ||
| + | .btn.active.focus { | ||
| + | outline: 5px auto -webkit-focus-ring-color; | ||
| + | outline-offset: -2px; | ||
| + | } | ||
| + | .btn:hover, | ||
| + | .btn:focus, | ||
| + | .btn.focus { | ||
| + | color: #333; | ||
| + | text-decoration: none; | ||
| + | } | ||
| + | .btn:active, | ||
| + | .btn.active { | ||
| + | background-image: none; | ||
| + | outline: 0; | ||
| + | -webkit-box-shadow: inset 0 3px 5px rgba(0, 0, 0, 0.125); | ||
| + | box-shadow: inset 0 3px 5px rgba(0, 0, 0, 0.125); | ||
| + | } | ||
| + | .btn.disabled, | ||
| + | .btn[disabled], | ||
| + | fieldset[disabled] .btn { | ||
| + | cursor: not-allowed; | ||
| + | filter: alpha(opacity=65); | ||
| + | opacity: 0.65; | ||
| + | -webkit-box-shadow: none; | ||
| + | box-shadow: none; | ||
| + | } | ||
| + | a.btn.disabled, | ||
| + | fieldset[disabled] a.btn { | ||
| + | pointer-events: none; | ||
| + | } | ||
| + | .btn-default { | ||
| + | color: #333; | ||
| + | background-color: #fff; | ||
| + | border-color: #ccc; | ||
| + | } | ||
| + | .btn-default:focus, | ||
| + | .btn-default.focus { | ||
| + | color: #333; | ||
| + | background-color: #e6e6e6; | ||
| + | border-color: #8c8c8c; | ||
| + | } | ||
| + | .btn-default:hover { | ||
| + | color: #333; | ||
| + | background-color: #e6e6e6; | ||
| + | border-color: #adadad; | ||
| + | } | ||
| + | .btn-default:active, | ||
| + | .btn-default.active, | ||
| + | .open > .dropdown-toggle.btn-default { | ||
| + | color: #333; | ||
| + | background-color: #e6e6e6; | ||
| + | background-image: none; | ||
| + | border-color: #adadad; | ||
| + | } | ||
| + | .btn-default:active:hover, | ||
| + | .btn-default.active:hover, | ||
| + | .open > .dropdown-toggle.btn-default:hover, | ||
| + | .btn-default:active:focus, | ||
| + | .btn-default.active:focus, | ||
| + | .open > .dropdown-toggle.btn-default:focus, | ||
| + | .btn-default:active.focus, | ||
| + | .btn-default.active.focus, | ||
| + | .open > .dropdown-toggle.btn-default.focus { | ||
| + | color: #333; | ||
| + | background-color: #d4d4d4; | ||
| + | border-color: #8c8c8c; | ||
| + | } | ||
| + | .btn-default.disabled:hover, | ||
| + | .btn-default[disabled]:hover, | ||
| + | fieldset[disabled] .btn-default:hover, | ||
| + | .btn-default.disabled:focus, | ||
| + | .btn-default[disabled]:focus, | ||
| + | fieldset[disabled] .btn-default:focus, | ||
| + | .btn-default.disabled.focus, | ||
| + | .btn-default[disabled].focus, | ||
| + | fieldset[disabled] .btn-default.focus { | ||
| + | background-color: #fff; | ||
| + | border-color: #ccc; | ||
| + | } | ||
| + | .btn-default .badge { | ||
| + | color: #fff; | ||
| + | background-color: #333; | ||
| + | } | ||
| + | .btn-primary { | ||
| + | color: #fff; | ||
| + | background-color: #337ab7; | ||
| + | border-color: #2e6da4; | ||
| + | } | ||
| + | .btn-primary:focus, | ||
| + | .btn-primary.focus { | ||
| + | color: #fff; | ||
| + | background-color: #286090; | ||
| + | border-color: #122b40; | ||
| + | } | ||
| + | .btn-primary:hover { | ||
| + | color: #fff; | ||
| + | background-color: #286090; | ||
| + | border-color: #204d74; | ||
| + | } | ||
| + | .btn-primary:active, | ||
| + | .btn-primary.active, | ||
| + | .open > .dropdown-toggle.btn-primary { | ||
| + | color: #fff; | ||
| + | background-color: #286090; | ||
| + | background-image: none; | ||
| + | border-color: #204d74; | ||
| + | } | ||
| + | .btn-primary:active:hover, | ||
| + | .btn-primary.active:hover, | ||
| + | .open > .dropdown-toggle.btn-primary:hover, | ||
| + | .btn-primary:active:focus, | ||
| + | .btn-primary.active:focus, | ||
| + | .open > .dropdown-toggle.btn-primary:focus, | ||
| + | .btn-primary:active.focus, | ||
| + | .btn-primary.active.focus, | ||
| + | .open > .dropdown-toggle.btn-primary.focus { | ||
| + | color: #fff; | ||
| + | background-color: #204d74; | ||
| + | border-color: #122b40; | ||
| + | } | ||
| + | .btn-primary.disabled:hover, | ||
| + | .btn-primary[disabled]:hover, | ||
| + | fieldset[disabled] .btn-primary:hover, | ||
| + | .btn-primary.disabled:focus, | ||
| + | .btn-primary[disabled]:focus, | ||
| + | fieldset[disabled] .btn-primary:focus, | ||
| + | .btn-primary.disabled.focus, | ||
| + | .btn-primary[disabled].focus, | ||
| + | fieldset[disabled] .btn-primary.focus { | ||
| + | background-color: #337ab7; | ||
| + | border-color: #2e6da4; | ||
| + | } | ||
| + | .btn-primary .badge { | ||
| + | color: #337ab7; | ||
| + | background-color: #fff; | ||
| + | } | ||
| + | .btn-success { | ||
| + | color: #fff; | ||
| + | background-color: #5cb85c; | ||
| + | border-color: #4cae4c; | ||
| + | } | ||
| + | .btn-success:focus, | ||
| + | .btn-success.focus { | ||
| + | color: #fff; | ||
| + | background-color: #449d44; | ||
| + | border-color: #255625; | ||
| + | } | ||
| + | .btn-success:hover { | ||
| + | color: #fff; | ||
| + | background-color: #449d44; | ||
| + | border-color: #398439; | ||
| + | } | ||
| + | .btn-success:active, | ||
| + | .btn-success.active, | ||
| + | .open > .dropdown-toggle.btn-success { | ||
| + | color: #fff; | ||
| + | background-color: #449d44; | ||
| + | background-image: none; | ||
| + | border-color: #398439; | ||
| + | } | ||
| + | .btn-success:active:hover, | ||
| + | .btn-success.active:hover, | ||
| + | .open > .dropdown-toggle.btn-success:hover, | ||
| + | .btn-success:active:focus, | ||
| + | .btn-success.active:focus, | ||
| + | .open > .dropdown-toggle.btn-success:focus, | ||
| + | .btn-success:active.focus, | ||
| + | .btn-success.active.focus, | ||
| + | .open > .dropdown-toggle.btn-success.focus { | ||
| + | color: #fff; | ||
| + | background-color: #398439; | ||
| + | border-color: #255625; | ||
| + | } | ||
| + | .btn-success.disabled:hover, | ||
| + | .btn-success[disabled]:hover, | ||
| + | fieldset[disabled] .btn-success:hover, | ||
| + | .btn-success.disabled:focus, | ||
| + | .btn-success[disabled]:focus, | ||
| + | fieldset[disabled] .btn-success:focus, | ||
| + | .btn-success.disabled.focus, | ||
| + | .btn-success[disabled].focus, | ||
| + | fieldset[disabled] .btn-success.focus { | ||
| + | background-color: #5cb85c; | ||
| + | border-color: #4cae4c; | ||
| + | } | ||
| + | .btn-success .badge { | ||
| + | color: #5cb85c; | ||
| + | background-color: #fff; | ||
| + | } | ||
| + | .btn-info { | ||
| + | color: #fff; | ||
| + | background-color: #5bc0de; | ||
| + | border-color: #46b8da; | ||
| + | } | ||
| + | .btn-info:focus, | ||
| + | .btn-info.focus { | ||
| + | color: #fff; | ||
| + | background-color: #31b0d5; | ||
| + | border-color: #1b6d85; | ||
| + | } | ||
| + | .btn-info:hover { | ||
| + | color: #fff; | ||
| + | background-color: #31b0d5; | ||
| + | border-color: #269abc; | ||
| + | } | ||
| + | .btn-info:active, | ||
| + | .btn-info.active, | ||
| + | .open > .dropdown-toggle.btn-info { | ||
| + | color: #fff; | ||
| + | background-color: #31b0d5; | ||
| + | background-image: none; | ||
| + | border-color: #269abc; | ||
| + | } | ||
| + | .btn-info:active:hover, | ||
| + | .btn-info.active:hover, | ||
| + | .open > .dropdown-toggle.btn-info:hover, | ||
| + | .btn-info:active:focus, | ||
| + | .btn-info.active:focus, | ||
| + | .open > .dropdown-toggle.btn-info:focus, | ||
| + | .btn-info:active.focus, | ||
| + | .btn-info.active.focus, | ||
| + | .open > .dropdown-toggle.btn-info.focus { | ||
| + | color: #fff; | ||
| + | background-color: #269abc; | ||
| + | border-color: #1b6d85; | ||
| + | } | ||
| + | .btn-info.disabled:hover, | ||
| + | .btn-info[disabled]:hover, | ||
| + | fieldset[disabled] .btn-info:hover, | ||
| + | .btn-info.disabled:focus, | ||
| + | .btn-info[disabled]:focus, | ||
| + | fieldset[disabled] .btn-info:focus, | ||
| + | .btn-info.disabled.focus, | ||
| + | .btn-info[disabled].focus, | ||
| + | fieldset[disabled] .btn-info.focus { | ||
| + | background-color: #5bc0de; | ||
| + | border-color: #46b8da; | ||
| + | } | ||
| + | .btn-info .badge { | ||
| + | color: #5bc0de; | ||
| + | background-color: #fff; | ||
| + | } | ||
| + | .btn-warning { | ||
| + | color: #fff; | ||
| + | background-color: #f0ad4e; | ||
| + | border-color: #eea236; | ||
| + | } | ||
| + | .btn-warning:focus, | ||
| + | .btn-warning.focus { | ||
| + | color: #fff; | ||
| + | background-color: #ec971f; | ||
| + | border-color: #985f0d; | ||
| + | } | ||
| + | .btn-warning:hover { | ||
| + | color: #fff; | ||
| + | background-color: #ec971f; | ||
| + | border-color: #d58512; | ||
| + | } | ||
| + | .btn-warning:active, | ||
| + | .btn-warning.active, | ||
| + | .open > .dropdown-toggle.btn-warning { | ||
| + | color: #fff; | ||
| + | background-color: #ec971f; | ||
| + | background-image: none; | ||
| + | border-color: #d58512; | ||
| + | } | ||
| + | .btn-warning:active:hover, | ||
| + | .btn-warning.active:hover, | ||
| + | .open > .dropdown-toggle.btn-warning:hover, | ||
| + | .btn-warning:active:focus, | ||
| + | .btn-warning.active:focus, | ||
| + | .open > .dropdown-toggle.btn-warning:focus, | ||
| + | .btn-warning:active.focus, | ||
| + | .btn-warning.active.focus, | ||
| + | .open > .dropdown-toggle.btn-warning.focus { | ||
| + | color: #fff; | ||
| + | background-color: #d58512; | ||
| + | border-color: #985f0d; | ||
| + | } | ||
| + | .btn-warning.disabled:hover, | ||
| + | .btn-warning[disabled]:hover, | ||
| + | fieldset[disabled] .btn-warning:hover, | ||
| + | .btn-warning.disabled:focus, | ||
| + | .btn-warning[disabled]:focus, | ||
| + | fieldset[disabled] .btn-warning:focus, | ||
| + | .btn-warning.disabled.focus, | ||
| + | .btn-warning[disabled].focus, | ||
| + | fieldset[disabled] .btn-warning.focus { | ||
| + | background-color: #f0ad4e; | ||
| + | border-color: #eea236; | ||
| + | } | ||
| + | .btn-warning .badge { | ||
| + | color: #f0ad4e; | ||
| + | background-color: #fff; | ||
| + | } | ||
| + | .btn-danger { | ||
| + | color: #fff; | ||
| + | background-color: #d9534f; | ||
| + | border-color: #d43f3a; | ||
| + | } | ||
| + | .btn-danger:focus, | ||
| + | .btn-danger.focus { | ||
| + | color: #fff; | ||
| + | background-color: #c9302c; | ||
| + | border-color: #761c19; | ||
| + | } | ||
| + | .btn-danger:hover { | ||
| + | color: #fff; | ||
| + | background-color: #c9302c; | ||
| + | border-color: #ac2925; | ||
| + | } | ||
| + | .btn-danger:active, | ||
| + | .btn-danger.active, | ||
| + | .open > .dropdown-toggle.btn-danger { | ||
| + | color: #fff; | ||
| + | background-color: #c9302c; | ||
| + | background-image: none; | ||
| + | border-color: #ac2925; | ||
| + | } | ||
| + | .btn-danger:active:hover, | ||
| + | .btn-danger.active:hover, | ||
| + | .open > .dropdown-toggle.btn-danger:hover, | ||
| + | .btn-danger:active:focus, | ||
| + | .btn-danger.active:focus, | ||
| + | .open > .dropdown-toggle.btn-danger:focus, | ||
| + | .btn-danger:active.focus, | ||
| + | .btn-danger.active.focus, | ||
| + | .open > .dropdown-toggle.btn-danger.focus { | ||
| + | color: #fff; | ||
| + | background-color: #ac2925; | ||
| + | border-color: #761c19; | ||
| + | } | ||
| + | .btn-danger.disabled:hover, | ||
| + | .btn-danger[disabled]:hover, | ||
| + | fieldset[disabled] .btn-danger:hover, | ||
| + | .btn-danger.disabled:focus, | ||
| + | .btn-danger[disabled]:focus, | ||
| + | fieldset[disabled] .btn-danger:focus, | ||
| + | .btn-danger.disabled.focus, | ||
| + | .btn-danger[disabled].focus, | ||
| + | fieldset[disabled] .btn-danger.focus { | ||
| + | background-color: #d9534f; | ||
| + | border-color: #d43f3a; | ||
| + | } | ||
| + | .btn-danger .badge { | ||
| + | color: #d9534f; | ||
| + | background-color: #fff; | ||
| + | } | ||
| + | .btn-link { | ||
| + | font-weight: 400; | ||
| + | color: #337ab7; | ||
| + | border-radius: 0; | ||
| + | } | ||
| + | .btn-link, | ||
| + | .btn-link:active, | ||
| + | .btn-link.active, | ||
| + | .btn-link[disabled], | ||
| + | fieldset[disabled] .btn-link { | ||
| + | background-color: transparent; | ||
| + | -webkit-box-shadow: none; | ||
| + | box-shadow: none; | ||
| + | } | ||
| + | .btn-link, | ||
| + | .btn-link:hover, | ||
| + | .btn-link:focus, | ||
| + | .btn-link:active { | ||
| + | border-color: transparent; | ||
| + | } | ||
| + | .btn-link:hover, | ||
| + | .btn-link:focus { | ||
| + | color: #23527c; | ||
| + | text-decoration: underline; | ||
| + | background-color: transparent; | ||
| + | } | ||
| + | .btn-link[disabled]:hover, | ||
| + | fieldset[disabled] .btn-link:hover, | ||
| + | .btn-link[disabled]:focus, | ||
| + | fieldset[disabled] .btn-link:focus { | ||
| + | color: #777777; | ||
| + | text-decoration: none; | ||
| + | } | ||
| + | .btn-lg, | ||
| + | .btn-group-lg > .btn { | ||
| + | padding: 10px 16px; | ||
| + | font-size: 18px; | ||
| + | line-height: 1.3333333; | ||
| + | border-radius: 6px; | ||
| + | } | ||
| + | .btn-sm, | ||
| + | .btn-group-sm > .btn { | ||
| + | padding: 5px 10px; | ||
| + | font-size: 12px; | ||
| + | line-height: 1.5; | ||
| + | border-radius: 3px; | ||
| + | } | ||
| + | .btn-xs, | ||
| + | .btn-group-xs > .btn { | ||
| + | padding: 1px 5px; | ||
| + | font-size: 12px; | ||
| + | line-height: 1.5; | ||
| + | border-radius: 3px; | ||
| + | } | ||
| + | .btn-block { | ||
| + | display: block; | ||
| + | width: 100%; | ||
| + | } | ||
| + | .btn-block + .btn-block { | ||
| + | margin-top: 5px; | ||
| + | } | ||
| + | input[type="submit"].btn-block, | ||
| + | input[type="reset"].btn-block, | ||
| + | input[type="button"].btn-block { | ||
| + | width: 100%; | ||
| + | } | ||
| + | .fade { | ||
| + | opacity: 0; | ||
| + | -webkit-transition: opacity 0.15s linear; | ||
| + | -o-transition: opacity 0.15s linear; | ||
| + | transition: opacity 0.15s linear; | ||
| + | } | ||
| + | .fade.in { | ||
| + | opacity: 1; | ||
| + | } | ||
| + | .collapse { | ||
| + | display: none; | ||
| + | } | ||
| + | .collapse.in { | ||
| + | display: block; | ||
| + | } | ||
| + | tr.collapse.in { | ||
| + | display: table-row; | ||
| + | } | ||
| + | tbody.collapse.in { | ||
| + | display: table-row-group; | ||
| + | } | ||
| + | .collapsing { | ||
| + | position: relative; | ||
| + | height: 0; | ||
| + | overflow: hidden; | ||
| + | -webkit-transition-property: height, visibility; | ||
| + | -o-transition-property: height, visibility; | ||
| + | transition-property: height, visibility; | ||
| + | -webkit-transition-duration: 0.35s; | ||
| + | -o-transition-duration: 0.35s; | ||
| + | transition-duration: 0.35s; | ||
| + | -webkit-transition-timing-function: ease; | ||
| + | -o-transition-timing-function: ease; | ||
| + | transition-timing-function: ease; | ||
| + | } | ||
| + | .caret { | ||
| + | display: inline-block; | ||
| + | width: 0; | ||
| + | height: 0; | ||
| + | margin-left: 2px; | ||
| + | vertical-align: middle; | ||
| + | border-top: 4px dashed; | ||
| + | border-top: 4px solid \9; | ||
| + | border-right: 4px solid transparent; | ||
| + | border-left: 4px solid transparent; | ||
| + | } | ||
| + | .dropup, | ||
| + | .dropdown { | ||
| + | position: relative; | ||
| + | } | ||
| + | .dropdown-toggle:focus { | ||
| + | outline: 0; | ||
| + | } | ||
| + | .dropdown-menu { | ||
| + | position: absolute; | ||
| + | top: 100%; | ||
| + | left: 0; | ||
| + | z-index: 1000; | ||
| + | display: none; | ||
| + | float: left; | ||
| + | min-width: 160px; | ||
| + | padding: 5px 0; | ||
| + | margin: 2px 0 0; | ||
| + | font-size: 14px; | ||
| + | text-align: left; | ||
| + | list-style: none; | ||
| + | background-color: #fff; | ||
| + | background-clip: padding-box; | ||
| + | border: 1px solid #ccc; | ||
| + | border: 1px solid rgba(0, 0, 0, 0.15); | ||
| + | border-radius: 4px; | ||
| + | -webkit-box-shadow: 0 6px 12px rgba(0, 0, 0, 0.175); | ||
| + | box-shadow: 0 6px 12px rgba(0, 0, 0, 0.175); | ||
| + | } | ||
| + | .dropdown-menu.pull-right { | ||
| + | right: 0; | ||
| + | left: auto; | ||
| + | } | ||
| + | .dropdown-menu .divider { | ||
| + | height: 1px; | ||
| + | margin: 9px 0; | ||
| + | overflow: hidden; | ||
| + | background-color: #e5e5e5; | ||
| + | } | ||
| + | .dropdown-menu > li > a { | ||
| + | display: block; | ||
| + | padding: 3px 20px; | ||
| + | clear: both; | ||
| + | font-weight: 400; | ||
| + | line-height: 1.42857143; | ||
| + | color: #333333; | ||
| + | white-space: nowrap; | ||
| + | } | ||
| + | .dropdown-menu > li > a:hover, | ||
| + | .dropdown-menu > li > a:focus { | ||
| + | color: #262626; | ||
| + | text-decoration: none; | ||
| + | background-color: #f5f5f5; | ||
| + | } | ||
| + | .dropdown-menu > .active > a, | ||
| + | .dropdown-menu > .active > a:hover, | ||
| + | .dropdown-menu > .active > a:focus { | ||
| + | color: #fff; | ||
| + | text-decoration: none; | ||
| + | background-color: #337ab7; | ||
| + | outline: 0; | ||
| + | } | ||
| + | .dropdown-menu > .disabled > a, | ||
| + | .dropdown-menu > .disabled > a:hover, | ||
| + | .dropdown-menu > .disabled > a:focus { | ||
| + | color: #777777; | ||
| + | } | ||
| + | .dropdown-menu > .disabled > a:hover, | ||
| + | .dropdown-menu > .disabled > a:focus { | ||
| + | text-decoration: none; | ||
| + | cursor: not-allowed; | ||
| + | background-color: transparent; | ||
| + | background-image: none; | ||
| + | filter: progid:DXImageTransform.Microsoft.gradient(enabled = false); | ||
| + | } | ||
| + | .open > .dropdown-menu { | ||
| + | display: block; | ||
| + | } | ||
| + | .open > a { | ||
| + | outline: 0; | ||
| + | } | ||
| + | .dropdown-menu-right { | ||
| + | right: 0; | ||
| + | left: auto; | ||
| + | } | ||
| + | .dropdown-menu-left { | ||
| + | right: auto; | ||
| + | left: 0; | ||
| + | } | ||
| + | .dropdown-header { | ||
| + | display: block; | ||
| + | padding: 3px 20px; | ||
| + | font-size: 12px; | ||
| + | line-height: 1.42857143; | ||
| + | color: #777777; | ||
| + | white-space: nowrap; | ||
| + | } | ||
| + | .dropdown-backdrop { | ||
| + | position: fixed; | ||
| + | top: 0; | ||
| + | right: 0; | ||
| + | bottom: 0; | ||
| + | left: 0; | ||
| + | z-index: 990; | ||
| + | } | ||
| + | .pull-right > .dropdown-menu { | ||
| + | right: 0; | ||
| + | left: auto; | ||
| + | } | ||
| + | .dropup .caret, | ||
| + | .navbar-fixed-bottom .dropdown .caret { | ||
| + | content: ""; | ||
| + | border-top: 0; | ||
| + | border-bottom: 4px dashed; | ||
| + | border-bottom: 4px solid \9; | ||
| + | } | ||
| + | .dropup .dropdown-menu, | ||
| + | .navbar-fixed-bottom .dropdown .dropdown-menu { | ||
| + | top: auto; | ||
| + | bottom: 100%; | ||
| + | margin-bottom: 2px; | ||
| + | } | ||
| + | @media (min-width: 768px) { | ||
| + | .navbar-right .dropdown-menu { | ||
| + | right: 0; | ||
| + | left: auto; | ||
| + | } | ||
| + | .navbar-right .dropdown-menu-left { | ||
| + | right: auto; | ||
| + | left: 0; | ||
| + | } | ||
| + | } | ||
| + | .btn-group, | ||
| + | .btn-group-vertical { | ||
| + | position: relative; | ||
| + | display: inline-block; | ||
| + | vertical-align: middle; | ||
| + | } | ||
| + | .btn-group > .btn, | ||
| + | .btn-group-vertical > .btn { | ||
| + | position: relative; | ||
| + | float: left; | ||
| + | } | ||
| + | .btn-group > .btn:hover, | ||
| + | .btn-group-vertical > .btn:hover, | ||
| + | .btn-group > .btn:focus, | ||
| + | .btn-group-vertical > .btn:focus, | ||
| + | .btn-group > .btn:active, | ||
| + | .btn-group-vertical > .btn:active, | ||
| + | .btn-group > .btn.active, | ||
| + | .btn-group-vertical > .btn.active { | ||
| + | z-index: 2; | ||
| + | } | ||
| + | .btn-group .btn + .btn, | ||
| + | .btn-group .btn + .btn-group, | ||
| + | .btn-group .btn-group + .btn, | ||
| + | .btn-group .btn-group + .btn-group { | ||
| + | margin-left: -1px; | ||
| + | } | ||
| + | .btn-toolbar { | ||
| + | margin-left: -5px; | ||
| + | } | ||
| + | .btn-toolbar .btn, | ||
| + | .btn-toolbar .btn-group, | ||
| + | .btn-toolbar .input-group { | ||
| + | float: left; | ||
| + | } | ||
| + | .btn-toolbar > .btn, | ||
| + | .btn-toolbar > .btn-group, | ||
| + | .btn-toolbar > .input-group { | ||
| + | margin-left: 5px; | ||
| + | } | ||
| + | .btn-group > .btn:not(:first-child):not(:last-child):not(.dropdown-toggle) { | ||
| + | border-radius: 0; | ||
| + | } | ||
| + | .btn-group > .btn:first-child { | ||
| + | margin-left: 0; | ||
| + | } | ||
| + | .btn-group > .btn:first-child:not(:last-child):not(.dropdown-toggle) { | ||
| + | border-top-right-radius: 0; | ||
| + | border-bottom-right-radius: 0; | ||
| + | } | ||
| + | .btn-group > .btn:last-child:not(:first-child), | ||
| + | .btn-group > .dropdown-toggle:not(:first-child) { | ||
| + | border-top-left-radius: 0; | ||
| + | border-bottom-left-radius: 0; | ||
| + | } | ||
| + | .btn-group > .btn-group { | ||
| + | float: left; | ||
| + | } | ||
| + | .btn-group > .btn-group:not(:first-child):not(:last-child) > .btn { | ||
| + | border-radius: 0; | ||
| + | } | ||
| + | .btn-group > .btn-group:first-child:not(:last-child) > .btn:last-child, | ||
| + | .btn-group > .btn-group:first-child:not(:last-child) > .dropdown-toggle { | ||
| + | border-top-right-radius: 0; | ||
| + | border-bottom-right-radius: 0; | ||
| + | } | ||
| + | .btn-group > .btn-group:last-child:not(:first-child) > .btn:first-child { | ||
| + | border-top-left-radius: 0; | ||
| + | border-bottom-left-radius: 0; | ||
| + | } | ||
| + | .btn-group .dropdown-toggle:active, | ||
| + | .btn-group.open .dropdown-toggle { | ||
| + | outline: 0; | ||
| + | } | ||
| + | .btn-group > .btn + .dropdown-toggle { | ||
| + | padding-right: 8px; | ||
| + | padding-left: 8px; | ||
| + | } | ||
| + | .btn-group > .btn-lg + .dropdown-toggle { | ||
| + | padding-right: 12px; | ||
| + | padding-left: 12px; | ||
| + | } | ||
| + | .btn-group.open .dropdown-toggle { | ||
| + | -webkit-box-shadow: inset 0 3px 5px rgba(0, 0, 0, 0.125); | ||
| + | box-shadow: inset 0 3px 5px rgba(0, 0, 0, 0.125); | ||
| + | } | ||
| + | .btn-group.open .dropdown-toggle.btn-link { | ||
| + | -webkit-box-shadow: none; | ||
| + | box-shadow: none; | ||
| + | } | ||
| + | .btn .caret { | ||
| + | margin-left: 0; | ||
| + | } | ||
| + | .btn-lg .caret { | ||
| + | border-width: 5px 5px 0; | ||
| + | border-bottom-width: 0; | ||
| + | } | ||
| + | .dropup .btn-lg .caret { | ||
| + | border-width: 0 5px 5px; | ||
| + | } | ||
| + | .btn-group-vertical > .btn, | ||
| + | .btn-group-vertical > .btn-group, | ||
| + | .btn-group-vertical > .btn-group > .btn { | ||
| + | display: block; | ||
| + | float: none; | ||
| + | width: 100%; | ||
| + | max-width: 100%; | ||
| + | } | ||
| + | .btn-group-vertical > .btn-group > .btn { | ||
| + | float: none; | ||
| + | } | ||
| + | .btn-group-vertical > .btn + .btn, | ||
| + | .btn-group-vertical > .btn + .btn-group, | ||
| + | .btn-group-vertical > .btn-group + .btn, | ||
| + | .btn-group-vertical > .btn-group + .btn-group { | ||
| + | margin-top: -1px; | ||
| + | margin-left: 0; | ||
| + | } | ||
| + | .btn-group-vertical > .btn:not(:first-child):not(:last-child) { | ||
| + | border-radius: 0; | ||
| + | } | ||
| + | .btn-group-vertical > .btn:first-child:not(:last-child) { | ||
| + | border-top-left-radius: 4px; | ||
| + | border-top-right-radius: 4px; | ||
| + | border-bottom-right-radius: 0; | ||
| + | border-bottom-left-radius: 0; | ||
| + | } | ||
| + | .btn-group-vertical > .btn:last-child:not(:first-child) { | ||
| + | border-top-left-radius: 0; | ||
| + | border-top-right-radius: 0; | ||
| + | border-bottom-right-radius: 4px; | ||
| + | border-bottom-left-radius: 4px; | ||
| + | } | ||
| + | .btn-group-vertical > .btn-group:not(:first-child):not(:last-child) > .btn { | ||
| + | border-radius: 0; | ||
| + | } | ||
| + | .btn-group-vertical > .btn-group:first-child:not(:last-child) > .btn:last-child, | ||
| + | .btn-group-vertical > .btn-group:first-child:not(:last-child) > .dropdown-toggle { | ||
| + | border-bottom-right-radius: 0; | ||
| + | border-bottom-left-radius: 0; | ||
| + | } | ||
| + | .btn-group-vertical > .btn-group:last-child:not(:first-child) > .btn:first-child { | ||
| + | border-top-left-radius: 0; | ||
| + | border-top-right-radius: 0; | ||
| + | } | ||
| + | .btn-group-justified { | ||
| + | display: table; | ||
| + | width: 100%; | ||
| + | table-layout: fixed; | ||
| + | border-collapse: separate; | ||
| + | } | ||
| + | .btn-group-justified > .btn, | ||
| + | .btn-group-justified > .btn-group { | ||
| + | display: table-cell; | ||
| + | float: none; | ||
| + | width: 1%; | ||
| + | } | ||
| + | .btn-group-justified > .btn-group .btn { | ||
| + | width: 100%; | ||
| + | } | ||
| + | .btn-group-justified > .btn-group .dropdown-menu { | ||
| + | left: auto; | ||
| + | } | ||
| + | [data-toggle="buttons"] > .btn input[type="radio"], | ||
| + | [data-toggle="buttons"] > .btn-group > .btn input[type="radio"], | ||
| + | [data-toggle="buttons"] > .btn input[type="checkbox"], | ||
| + | [data-toggle="buttons"] > .btn-group > .btn input[type="checkbox"] { | ||
| + | position: absolute; | ||
| + | clip: rect(0, 0, 0, 0); | ||
| + | pointer-events: none; | ||
| + | } | ||
| + | .input-group { | ||
| + | position: relative; | ||
| + | display: table; | ||
| + | border-collapse: separate; | ||
| + | } | ||
| + | .input-group[class*="col-"] { | ||
| + | float: none; | ||
| + | padding-right: 0; | ||
| + | padding-left: 0; | ||
| + | } | ||
| + | .input-group .form-control { | ||
| + | position: relative; | ||
| + | z-index: 2; | ||
| + | float: left; | ||
| + | width: 100%; | ||
| + | margin-bottom: 0; | ||
| + | } | ||
| + | .input-group .form-control:focus { | ||
| + | z-index: 3; | ||
| + | } | ||
| + | .input-group-lg > .form-control, | ||
| + | .input-group-lg > .input-group-addon, | ||
| + | .input-group-lg > .input-group-btn > .btn { | ||
| + | height: 46px; | ||
| + | padding: 10px 16px; | ||
| + | font-size: 18px; | ||
| + | line-height: 1.3333333; | ||
| + | border-radius: 6px; | ||
| + | } | ||
| + | select.input-group-lg > .form-control, | ||
| + | select.input-group-lg > .input-group-addon, | ||
| + | select.input-group-lg > .input-group-btn > .btn { | ||
| + | height: 46px; | ||
| + | line-height: 46px; | ||
| + | } | ||
| + | textarea.input-group-lg > .form-control, | ||
| + | textarea.input-group-lg > .input-group-addon, | ||
| + | textarea.input-group-lg > .input-group-btn > .btn, | ||
| + | select[multiple].input-group-lg > .form-control, | ||
| + | select[multiple].input-group-lg > .input-group-addon, | ||
| + | select[multiple].input-group-lg > .input-group-btn > .btn { | ||
| + | height: auto; | ||
| + | } | ||
| + | .input-group-sm > .form-control, | ||
| + | .input-group-sm > .input-group-addon, | ||
| + | .input-group-sm > .input-group-btn > .btn { | ||
| + | height: 30px; | ||
| + | padding: 5px 10px; | ||
| + | font-size: 12px; | ||
| + | line-height: 1.5; | ||
| + | border-radius: 3px; | ||
| + | } | ||
| + | select.input-group-sm > .form-control, | ||
| + | select.input-group-sm > .input-group-addon, | ||
| + | select.input-group-sm > .input-group-btn > .btn { | ||
| + | height: 30px; | ||
| + | line-height: 30px; | ||
| + | } | ||
| + | textarea.input-group-sm > .form-control, | ||
| + | textarea.input-group-sm > .input-group-addon, | ||
| + | textarea.input-group-sm > .input-group-btn > .btn, | ||
| + | select[multiple].input-group-sm > .form-control, | ||
| + | select[multiple].input-group-sm > .input-group-addon, | ||
| + | select[multiple].input-group-sm > .input-group-btn > .btn { | ||
| + | height: auto; | ||
| + | } | ||
| + | .input-group-addon, | ||
| + | .input-group-btn, | ||
| + | .input-group .form-control { | ||
| + | display: table-cell; | ||
| + | } | ||
| + | .input-group-addon:not(:first-child):not(:last-child), | ||
| + | .input-group-btn:not(:first-child):not(:last-child), | ||
| + | .input-group .form-control:not(:first-child):not(:last-child) { | ||
| + | border-radius: 0; | ||
| + | } | ||
| + | .input-group-addon, | ||
| + | .input-group-btn { | ||
| + | width: 1%; | ||
| + | white-space: nowrap; | ||
| + | vertical-align: middle; | ||
| + | } | ||
| + | .input-group-addon { | ||
| + | padding: 6px 12px; | ||
| + | font-size: 14px; | ||
| + | font-weight: 400; | ||
| + | line-height: 1; | ||
| + | color: #555555; | ||
| + | text-align: center; | ||
| + | background-color: #eeeeee; | ||
| + | border: 1px solid #ccc; | ||
| + | border-radius: 4px; | ||
| + | } | ||
| + | .input-group-addon.input-sm { | ||
| + | padding: 5px 10px; | ||
| + | font-size: 12px; | ||
| + | border-radius: 3px; | ||
| + | } | ||
| + | .input-group-addon.input-lg { | ||
| + | padding: 10px 16px; | ||
| + | font-size: 18px; | ||
| + | border-radius: 6px; | ||
| + | } | ||
| + | .input-group-addon input[type="radio"], | ||
| + | .input-group-addon input[type="checkbox"] { | ||
| + | margin-top: 0; | ||
| + | } | ||
| + | .input-group .form-control:first-child, | ||
| + | .input-group-addon:first-child, | ||
| + | .input-group-btn:first-child > .btn, | ||
| + | .input-group-btn:first-child > .btn-group > .btn, | ||
| + | .input-group-btn:first-child > .dropdown-toggle, | ||
| + | .input-group-btn:last-child > .btn:not(:last-child):not(.dropdown-toggle), | ||
| + | .input-group-btn:last-child > .btn-group:not(:last-child) > .btn { | ||
| + | border-top-right-radius: 0; | ||
| + | border-bottom-right-radius: 0; | ||
| + | } | ||
| + | .input-group-addon:first-child { | ||
| + | border-right: 0; | ||
| + | } | ||
| + | .input-group .form-control:last-child, | ||
| + | .input-group-addon:last-child, | ||
| + | .input-group-btn:last-child > .btn, | ||
| + | .input-group-btn:last-child > .btn-group > .btn, | ||
| + | .input-group-btn:last-child > .dropdown-toggle, | ||
| + | .input-group-btn:first-child > .btn:not(:first-child), | ||
| + | .input-group-btn:first-child > .btn-group:not(:first-child) > .btn { | ||
| + | border-top-left-radius: 0; | ||
| + | border-bottom-left-radius: 0; | ||
| + | } | ||
| + | .input-group-addon:last-child { | ||
| + | border-left: 0; | ||
| + | } | ||
| + | .input-group-btn { | ||
| + | position: relative; | ||
| + | font-size: 0; | ||
| + | white-space: nowrap; | ||
| + | } | ||
| + | .input-group-btn > .btn { | ||
| + | position: relative; | ||
| + | } | ||
| + | .input-group-btn > .btn + .btn { | ||
| + | margin-left: -1px; | ||
| + | } | ||
| + | .input-group-btn > .btn:hover, | ||
| + | .input-group-btn > .btn:focus, | ||
| + | .input-group-btn > .btn:active { | ||
| + | z-index: 2; | ||
| + | } | ||
| + | .input-group-btn:first-child > .btn, | ||
| + | .input-group-btn:first-child > .btn-group { | ||
| + | margin-right: -1px; | ||
| + | } | ||
| + | .input-group-btn:last-child > .btn, | ||
| + | .input-group-btn:last-child > .btn-group { | ||
| + | z-index: 2; | ||
| + | margin-left: -1px; | ||
| + | } | ||
| + | .nav { | ||
| + | padding-left: 0; | ||
| + | margin-bottom: 0; | ||
| + | list-style: none; | ||
| + | } | ||
| + | .nav > li { | ||
| + | position: relative; | ||
| + | display: block; | ||
| + | } | ||
| + | .nav > li > a { | ||
| + | position: relative; | ||
| + | display: block; | ||
| + | padding: 10px 15px; | ||
| + | } | ||
| + | .nav > li > a:hover, | ||
| + | .nav > li > a:focus { | ||
| + | text-decoration: none; | ||
| + | background-color: #eeeeee; | ||
| + | } | ||
| + | .nav > li.disabled > a { | ||
| + | color: #777777; | ||
| + | } | ||
| + | .nav > li.disabled > a:hover, | ||
| + | .nav > li.disabled > a:focus { | ||
| + | color: #777777; | ||
| + | text-decoration: none; | ||
| + | cursor: not-allowed; | ||
| + | background-color: transparent; | ||
| + | } | ||
| + | .nav .open > a, | ||
| + | .nav .open > a:hover, | ||
| + | .nav .open > a:focus { | ||
| + | background-color: #eeeeee; | ||
| + | border-color: #337ab7; | ||
| + | } | ||
| + | .nav .nav-divider { | ||
| + | height: 1px; | ||
| + | margin: 9px 0; | ||
| + | overflow: hidden; | ||
| + | background-color: #e5e5e5; | ||
| + | } | ||
| + | .nav > li > a > img { | ||
| + | max-width: none; | ||
| + | } | ||
| + | .nav-tabs { | ||
| + | border-bottom: 1px solid #ddd; | ||
| + | } | ||
| + | .nav-tabs > li { | ||
| + | float: left; | ||
| + | margin-bottom: -1px; | ||
| + | } | ||
| + | .nav-tabs > li > a { | ||
| + | margin-right: 2px; | ||
| + | line-height: 1.42857143; | ||
| + | border: 1px solid transparent; | ||
| + | border-radius: 4px 4px 0 0; | ||
| + | } | ||
| + | .nav-tabs > li > a:hover { | ||
| + | border-color: #eeeeee #eeeeee #ddd; | ||
| + | } | ||
| + | .nav-tabs > li.active > a, | ||
| + | .nav-tabs > li.active > a:hover, | ||
| + | .nav-tabs > li.active > a:focus { | ||
| + | color: #555555; | ||
| + | cursor: default; | ||
| + | background-color: #fff; | ||
| + | border: 1px solid #ddd; | ||
| + | border-bottom-color: transparent; | ||
| + | } | ||
| + | .nav-tabs.nav-justified { | ||
| + | width: 100%; | ||
| + | border-bottom: 0; | ||
| + | } | ||
| + | .nav-tabs.nav-justified > li { | ||
| + | float: none; | ||
| + | } | ||
| + | .nav-tabs.nav-justified > li > a { | ||
| + | margin-bottom: 5px; | ||
| + | text-align: center; | ||
| + | } | ||
| + | .nav-tabs.nav-justified > .dropdown .dropdown-menu { | ||
| + | top: auto; | ||
| + | left: auto; | ||
| + | } | ||
| + | @media (min-width: 768px) { | ||
| + | .nav-tabs.nav-justified > li { | ||
| + | display: table-cell; | ||
| + | width: 1%; | ||
| + | } | ||
| + | .nav-tabs.nav-justified > li > a { | ||
| + | margin-bottom: 0; | ||
| + | } | ||
| + | } | ||
| + | .nav-tabs.nav-justified > li > a { | ||
| + | margin-right: 0; | ||
| + | border-radius: 4px; | ||
| + | } | ||
| + | .nav-tabs.nav-justified > .active > a, | ||
| + | .nav-tabs.nav-justified > .active > a:hover, | ||
| + | .nav-tabs.nav-justified > .active > a:focus { | ||
| + | border: 1px solid #ddd; | ||
| + | } | ||
| + | @media (min-width: 768px) { | ||
| + | .nav-tabs.nav-justified > li > a { | ||
| + | border-bottom: 1px solid #ddd; | ||
| + | border-radius: 4px 4px 0 0; | ||
| + | } | ||
| + | .nav-tabs.nav-justified > .active > a, | ||
| + | .nav-tabs.nav-justified > .active > a:hover, | ||
| + | .nav-tabs.nav-justified > .active > a:focus { | ||
| + | border-bottom-color: #fff; | ||
| + | } | ||
| + | } | ||
| + | .nav-pills > li { | ||
| + | float: left; | ||
| + | } | ||
| + | .nav-pills > li > a { | ||
| + | border-radius: 4px; | ||
| + | } | ||
| + | .nav-pills > li + li { | ||
| + | margin-left: 2px; | ||
| + | } | ||
| + | .nav-pills > li.active > a, | ||
| + | .nav-pills > li.active > a:hover, | ||
| + | .nav-pills > li.active > a:focus { | ||
| + | color: #fff; | ||
| + | background-color: #337ab7; | ||
| + | } | ||
| + | .nav-stacked > li { | ||
| + | float: none; | ||
| + | } | ||
| + | .nav-stacked > li + li { | ||
| + | margin-top: 2px; | ||
| + | margin-left: 0; | ||
| + | } | ||
| + | .nav-justified { | ||
| + | width: 100%; | ||
| + | } | ||
| + | .nav-justified > li { | ||
| + | float: none; | ||
| + | } | ||
| + | .nav-justified > li > a { | ||
| + | margin-bottom: 5px; | ||
| + | text-align: center; | ||
| + | } | ||
| + | .nav-justified > .dropdown .dropdown-menu { | ||
| + | top: auto; | ||
| + | left: auto; | ||
| + | } | ||
| + | @media (min-width: 768px) { | ||
| + | .nav-justified > li { | ||
| + | display: table-cell; | ||
| + | width: 1%; | ||
| + | } | ||
| + | .nav-justified > li > a { | ||
| + | margin-bottom: 0; | ||
| + | } | ||
| + | } | ||
| + | .nav-tabs-justified { | ||
| + | border-bottom: 0; | ||
| + | } | ||
| + | .nav-tabs-justified > li > a { | ||
| + | margin-right: 0; | ||
| + | border-radius: 4px; | ||
| + | } | ||
| + | .nav-tabs-justified > .active > a, | ||
| + | .nav-tabs-justified > .active > a:hover, | ||
| + | .nav-tabs-justified > .active > a:focus { | ||
| + | border: 1px solid #ddd; | ||
| + | } | ||
| + | @media (min-width: 768px) { | ||
| + | .nav-tabs-justified > li > a { | ||
| + | border-bottom: 1px solid #ddd; | ||
| + | border-radius: 4px 4px 0 0; | ||
| + | } | ||
| + | .nav-tabs-justified > .active > a, | ||
| + | .nav-tabs-justified > .active > a:hover, | ||
| + | .nav-tabs-justified > .active > a:focus { | ||
| + | border-bottom-color: #fff; | ||
| + | } | ||
| + | } | ||
| + | .tab-content > .tab-pane { | ||
| + | display: none; | ||
| + | } | ||
| + | .tab-content > .active { | ||
| + | display: block; | ||
| + | } | ||
| + | .nav-tabs .dropdown-menu { | ||
| + | margin-top: -1px; | ||
| + | border-top-left-radius: 0; | ||
| + | border-top-right-radius: 0; | ||
| + | } | ||
| + | .navbar { | ||
| + | position: relative; | ||
| + | min-height: 50px; | ||
| + | margin-bottom: 20px; | ||
| + | border: 1px solid transparent; | ||
| + | } | ||
| + | @media (min-width: 768px) { | ||
| + | .navbar { | ||
| + | border-radius: 4px; | ||
| + | } | ||
| + | } | ||
| + | @media (min-width: 768px) { | ||
| + | .navbar-header { | ||
| + | float: left; | ||
| + | } | ||
| + | } | ||
| + | .navbar-collapse { | ||
| + | padding-right: 15px; | ||
| + | padding-left: 15px; | ||
| + | overflow-x: visible; | ||
| + | border-top: 1px solid transparent; | ||
| + | -webkit-box-shadow: inset 0 1px 0 rgba(255, 255, 255, 0.1); | ||
| + | box-shadow: inset 0 1px 0 rgba(255, 255, 255, 0.1); | ||
| + | -webkit-overflow-scrolling: touch; | ||
| + | } | ||
| + | .navbar-collapse.in { | ||
| + | overflow-y: auto; | ||
| + | } | ||
| + | @media (min-width: 768px) { | ||
| + | .navbar-collapse { | ||
| + | width: auto; | ||
| + | border-top: 0; | ||
| + | -webkit-box-shadow: none; | ||
| + | box-shadow: none; | ||
| + | } | ||
| + | .navbar-collapse.collapse { | ||
| + | display: block !important; | ||
| + | height: auto !important; | ||
| + | padding-bottom: 0; | ||
| + | overflow: visible !important; | ||
| + | } | ||
| + | .navbar-collapse.in { | ||
| + | overflow-y: visible; | ||
| + | } | ||
| + | .navbar-fixed-top .navbar-collapse, | ||
| + | .navbar-static-top .navbar-collapse, | ||
| + | .navbar-fixed-bottom .navbar-collapse { | ||
| + | padding-right: 0; | ||
| + | padding-left: 0; | ||
| + | } | ||
| + | } | ||
| + | .navbar-fixed-top, | ||
| + | .navbar-fixed-bottom { | ||
| + | position: fixed; | ||
| + | right: 0; | ||
| + | left: 0; | ||
| + | z-index: 1030; | ||
| + | } | ||
| + | .navbar-fixed-top .navbar-collapse, | ||
| + | .navbar-fixed-bottom .navbar-collapse { | ||
| + | max-height: 340px; | ||
| + | } | ||
| + | @media (max-device-width: 480px) and (orientation: landscape) { | ||
| + | .navbar-fixed-top .navbar-collapse, | ||
| + | .navbar-fixed-bottom .navbar-collapse { | ||
| + | max-height: 200px; | ||
| + | } | ||
| + | } | ||
| + | @media (min-width: 768px) { | ||
| + | .navbar-fixed-top, | ||
| + | .navbar-fixed-bottom { | ||
| + | border-radius: 0; | ||
| + | } | ||
| + | } | ||
| + | .navbar-fixed-top { | ||
| + | top: 0; | ||
| + | border-width: 0 0 1px; | ||
| + | } | ||
| + | .navbar-fixed-bottom { | ||
| + | bottom: 0; | ||
| + | margin-bottom: 0; | ||
| + | border-width: 1px 0 0; | ||
| + | } | ||
| + | .container > .navbar-header, | ||
| + | .container-fluid > .navbar-header, | ||
| + | .container > .navbar-collapse, | ||
| + | .container-fluid > .navbar-collapse { | ||
| + | margin-right: -15px; | ||
| + | margin-left: -15px; | ||
| + | } | ||
| + | @media (min-width: 768px) { | ||
| + | .container > .navbar-header, | ||
| + | .container-fluid > .navbar-header, | ||
| + | .container > .navbar-collapse, | ||
| + | .container-fluid > .navbar-collapse { | ||
| + | margin-right: 0; | ||
| + | margin-left: 0; | ||
| + | } | ||
| + | } | ||
| + | .navbar-static-top { | ||
| + | z-index: 1000; | ||
| + | border-width: 0 0 1px; | ||
| + | } | ||
| + | @media (min-width: 768px) { | ||
| + | .navbar-static-top { | ||
| + | border-radius: 0; | ||
| + | } | ||
| + | } | ||
| + | .navbar-brand { | ||
| + | float: left; | ||
| + | height: 50px; | ||
| + | padding: 15px 15px; | ||
| + | font-size: 18px; | ||
| + | line-height: 20px; | ||
| + | } | ||
| + | .navbar-brand:hover, | ||
| + | .navbar-brand:focus { | ||
| + | text-decoration: none; | ||
| + | } | ||
| + | .navbar-brand > img { | ||
| + | display: block; | ||
| + | } | ||
| + | @media (min-width: 768px) { | ||
| + | .navbar > .container .navbar-brand, | ||
| + | .navbar > .container-fluid .navbar-brand { | ||
| + | margin-left: -15px; | ||
| + | } | ||
| + | } | ||
| + | .navbar-toggle { | ||
| + | position: relative; | ||
| + | float: right; | ||
| + | padding: 9px 10px; | ||
| + | margin-right: 15px; | ||
| + | margin-top: 8px; | ||
| + | margin-bottom: 8px; | ||
| + | background-color: transparent; | ||
| + | background-image: none; | ||
| + | border: 1px solid transparent; | ||
| + | border-radius: 4px; | ||
| + | } | ||
| + | .navbar-toggle:focus { | ||
| + | outline: 0; | ||
| + | } | ||
| + | .navbar-toggle .icon-bar { | ||
| + | display: block; | ||
| + | width: 22px; | ||
| + | height: 2px; | ||
| + | border-radius: 1px; | ||
| + | } | ||
| + | .navbar-toggle .icon-bar + .icon-bar { | ||
| + | margin-top: 4px; | ||
| + | } | ||
| + | @media (min-width: 768px) { | ||
| + | .navbar-toggle { | ||
| + | display: none; | ||
| + | } | ||
| + | } | ||
| + | .navbar-nav { | ||
| + | margin: 7.5px -15px; | ||
| + | } | ||
| + | .navbar-nav > li > a { | ||
| + | padding-top: 10px; | ||
| + | padding-bottom: 10px; | ||
| + | line-height: 20px; | ||
| + | } | ||
| + | @media (max-width: 767px) { | ||
| + | .navbar-nav .open .dropdown-menu { | ||
| + | position: static; | ||
| + | float: none; | ||
| + | width: auto; | ||
| + | margin-top: 0; | ||
| + | background-color: transparent; | ||
| + | border: 0; | ||
| + | -webkit-box-shadow: none; | ||
| + | box-shadow: none; | ||
| + | } | ||
| + | .navbar-nav .open .dropdown-menu > li > a, | ||
| + | .navbar-nav .open .dropdown-menu .dropdown-header { | ||
| + | padding: 5px 15px 5px 25px; | ||
| + | } | ||
| + | .navbar-nav .open .dropdown-menu > li > a { | ||
| + | line-height: 20px; | ||
| + | } | ||
| + | .navbar-nav .open .dropdown-menu > li > a:hover, | ||
| + | .navbar-nav .open .dropdown-menu > li > a:focus { | ||
| + | background-image: none; | ||
| + | } | ||
| + | } | ||
| + | @media (min-width: 768px) { | ||
| + | .navbar-nav { | ||
| + | float: left; | ||
| + | margin: 0; | ||
| + | } | ||
| + | .navbar-nav > li { | ||
| + | float: left; | ||
| + | } | ||
| + | .navbar-nav > li > a { | ||
| + | padding-top: 15px; | ||
| + | padding-bottom: 15px; | ||
| + | } | ||
| + | } | ||
| + | .navbar-form { | ||
| + | padding: 10px 15px; | ||
| + | margin-right: -15px; | ||
| + | margin-left: -15px; | ||
| + | border-top: 1px solid transparent; | ||
| + | border-bottom: 1px solid transparent; | ||
| + | -webkit-box-shadow: inset 0 1px 0 rgba(255, 255, 255, 0.1), 0 1px 0 rgba(255, 255, 255, 0.1); | ||
| + | box-shadow: inset 0 1px 0 rgba(255, 255, 255, 0.1), 0 1px 0 rgba(255, 255, 255, 0.1); | ||
| + | margin-top: 8px; | ||
| + | margin-bottom: 8px; | ||
| + | } | ||
| + | @media (min-width: 768px) { | ||
| + | .navbar-form .form-group { | ||
| + | display: inline-block; | ||
| + | margin-bottom: 0; | ||
| + | vertical-align: middle; | ||
| + | } | ||
| + | .navbar-form .form-control { | ||
| + | display: inline-block; | ||
| + | width: auto; | ||
| + | vertical-align: middle; | ||
| + | } | ||
| + | .navbar-form .form-control-static { | ||
| + | display: inline-block; | ||
| + | } | ||
| + | .navbar-form .input-group { | ||
| + | display: inline-table; | ||
| + | vertical-align: middle; | ||
| + | } | ||
| + | .navbar-form .input-group .input-group-addon, | ||
| + | .navbar-form .input-group .input-group-btn, | ||
| + | .navbar-form .input-group .form-control { | ||
| + | width: auto; | ||
| + | } | ||
| + | .navbar-form .input-group > .form-control { | ||
| + | width: 100%; | ||
| + | } | ||
| + | .navbar-form .control-label { | ||
| + | margin-bottom: 0; | ||
| + | vertical-align: middle; | ||
| + | } | ||
| + | .navbar-form .radio, | ||
| + | .navbar-form .checkbox { | ||
| + | display: inline-block; | ||
| + | margin-top: 0; | ||
| + | margin-bottom: 0; | ||
| + | vertical-align: middle; | ||
| + | } | ||
| + | .navbar-form .radio label, | ||
| + | .navbar-form .checkbox label { | ||
| + | padding-left: 0; | ||
| + | } | ||
| + | .navbar-form .radio input[type="radio"], | ||
| + | .navbar-form .checkbox input[type="checkbox"] { | ||
| + | position: relative; | ||
| + | margin-left: 0; | ||
| + | } | ||
| + | .navbar-form .has-feedback .form-control-feedback { | ||
| + | top: 0; | ||
| + | } | ||
| + | } | ||
| + | @media (max-width: 767px) { | ||
| + | .navbar-form .form-group { | ||
| + | margin-bottom: 5px; | ||
| + | } | ||
| + | .navbar-form .form-group:last-child { | ||
| + | margin-bottom: 0; | ||
| + | } | ||
| + | } | ||
| + | @media (min-width: 768px) { | ||
| + | .navbar-form { | ||
| + | width: auto; | ||
| + | padding-top: 0; | ||
| + | padding-bottom: 0; | ||
| + | margin-right: 0; | ||
| + | margin-left: 0; | ||
| + | border: 0; | ||
| + | -webkit-box-shadow: none; | ||
| + | box-shadow: none; | ||
| + | } | ||
| + | } | ||
| + | .navbar-nav > li > .dropdown-menu { | ||
| + | margin-top: 0; | ||
| + | border-top-left-radius: 0; | ||
| + | border-top-right-radius: 0; | ||
| + | } | ||
| + | .navbar-fixed-bottom .navbar-nav > li > .dropdown-menu { | ||
| + | margin-bottom: 0; | ||
| + | border-top-left-radius: 4px; | ||
| + | border-top-right-radius: 4px; | ||
| + | border-bottom-right-radius: 0; | ||
| + | border-bottom-left-radius: 0; | ||
| + | } | ||
| + | .navbar-btn { | ||
| + | margin-top: 8px; | ||
| + | margin-bottom: 8px; | ||
| + | } | ||
| + | .navbar-btn.btn-sm { | ||
| + | margin-top: 10px; | ||
| + | margin-bottom: 10px; | ||
| + | } | ||
| + | .navbar-btn.btn-xs { | ||
| + | margin-top: 14px; | ||
| + | margin-bottom: 14px; | ||
| + | } | ||
| + | .navbar-text { | ||
| + | margin-top: 15px; | ||
| + | margin-bottom: 15px; | ||
| + | } | ||
| + | @media (min-width: 768px) { | ||
| + | .navbar-text { | ||
| + | float: left; | ||
| + | margin-right: 15px; | ||
| + | margin-left: 15px; | ||
| + | } | ||
| + | } | ||
| + | @media (min-width: 768px) { | ||
| + | .navbar-left { | ||
| + | float: left !important; | ||
| + | } | ||
| + | .navbar-right { | ||
| + | float: right !important; | ||
| + | margin-right: -15px; | ||
| + | } | ||
| + | .navbar-right ~ .navbar-right { | ||
| + | margin-right: 0; | ||
| + | } | ||
| + | } | ||
| + | .navbar-default { | ||
| + | background-color: #f8f8f8; | ||
| + | border-color: #e7e7e7; | ||
| + | } | ||
| + | .navbar-default .navbar-brand { | ||
| + | color: #777; | ||
| + | } | ||
| + | .navbar-default .navbar-brand:hover, | ||
| + | .navbar-default .navbar-brand:focus { | ||
| + | color: #5e5e5e; | ||
| + | background-color: transparent; | ||
| + | } | ||
| + | .navbar-default .navbar-text { | ||
| + | color: #777; | ||
| + | } | ||
| + | .navbar-default .navbar-nav > li > a { | ||
| + | color: #777; | ||
| + | } | ||
| + | .navbar-default .navbar-nav > li > a:hover, | ||
| + | .navbar-default .navbar-nav > li > a:focus { | ||
| + | color: #333; | ||
| + | background-color: transparent; | ||
| + | } | ||
| + | .navbar-default .navbar-nav > .active > a, | ||
| + | .navbar-default .navbar-nav > .active > a:hover, | ||
| + | .navbar-default .navbar-nav > .active > a:focus { | ||
| + | color: #555; | ||
| + | background-color: #e7e7e7; | ||
| + | } | ||
| + | .navbar-default .navbar-nav > .disabled > a, | ||
| + | .navbar-default .navbar-nav > .disabled > a:hover, | ||
| + | .navbar-default .navbar-nav > .disabled > a:focus { | ||
| + | color: #ccc; | ||
| + | background-color: transparent; | ||
| + | } | ||
| + | .navbar-default .navbar-nav > .open > a, | ||
| + | .navbar-default .navbar-nav > .open > a:hover, | ||
| + | .navbar-default .navbar-nav > .open > a:focus { | ||
| + | color: #555; | ||
| + | background-color: #e7e7e7; | ||
| + | } | ||
| + | @media (max-width: 767px) { | ||
| + | .navbar-default .navbar-nav .open .dropdown-menu > li > a { | ||
| + | color: #777; | ||
| + | } | ||
| + | .navbar-default .navbar-nav .open .dropdown-menu > li > a:hover, | ||
| + | .navbar-default .navbar-nav .open .dropdown-menu > li > a:focus { | ||
| + | color: #333; | ||
| + | background-color: transparent; | ||
| + | } | ||
| + | .navbar-default .navbar-nav .open .dropdown-menu > .active > a, | ||
| + | .navbar-default .navbar-nav .open .dropdown-menu > .active > a:hover, | ||
| + | .navbar-default .navbar-nav .open .dropdown-menu > .active > a:focus { | ||
| + | color: #555; | ||
| + | background-color: #e7e7e7; | ||
| + | } | ||
| + | .navbar-default .navbar-nav .open .dropdown-menu > .disabled > a, | ||
| + | .navbar-default .navbar-nav .open .dropdown-menu > .disabled > a:hover, | ||
| + | .navbar-default .navbar-nav .open .dropdown-menu > .disabled > a:focus { | ||
| + | color: #ccc; | ||
| + | background-color: transparent; | ||
| + | } | ||
| + | } | ||
| + | .navbar-default .navbar-toggle { | ||
| + | border-color: #ddd; | ||
| + | } | ||
| + | .navbar-default .navbar-toggle:hover, | ||
| + | .navbar-default .navbar-toggle:focus { | ||
| + | background-color: #ddd; | ||
| + | } | ||
| + | .navbar-default .navbar-toggle .icon-bar { | ||
| + | background-color: #888; | ||
| + | } | ||
| + | .navbar-default .navbar-collapse, | ||
| + | .navbar-default .navbar-form { | ||
| + | border-color: #e7e7e7; | ||
| + | } | ||
| + | .navbar-default .navbar-link { | ||
| + | color: #777; | ||
| + | } | ||
| + | .navbar-default .navbar-link:hover { | ||
| + | color: #333; | ||
| + | } | ||
| + | .navbar-default .btn-link { | ||
| + | color: #777; | ||
| + | } | ||
| + | .navbar-default .btn-link:hover, | ||
| + | .navbar-default .btn-link:focus { | ||
| + | color: #333; | ||
| + | } | ||
| + | .navbar-default .btn-link[disabled]:hover, | ||
| + | fieldset[disabled] .navbar-default .btn-link:hover, | ||
| + | .navbar-default .btn-link[disabled]:focus, | ||
| + | fieldset[disabled] .navbar-default .btn-link:focus { | ||
| + | color: #ccc; | ||
| + | } | ||
| + | .navbar-inverse { | ||
| + | background-color: #222; | ||
| + | border-color: #080808; | ||
| + | } | ||
| + | .navbar-inverse .navbar-brand { | ||
| + | color: #9d9d9d; | ||
| + | } | ||
| + | .navbar-inverse .navbar-brand:hover, | ||
| + | .navbar-inverse .navbar-brand:focus { | ||
| + | color: #fff; | ||
| + | background-color: transparent; | ||
| + | } | ||
| + | .navbar-inverse .navbar-text { | ||
| + | color: #9d9d9d; | ||
| + | } | ||
| + | .navbar-inverse .navbar-nav > li > a { | ||
| + | color: #9d9d9d; | ||
| + | } | ||
| + | .navbar-inverse .navbar-nav > li > a:hover, | ||
| + | .navbar-inverse .navbar-nav > li > a:focus { | ||
| + | color: #fff; | ||
| + | background-color: transparent; | ||
| + | } | ||
| + | .navbar-inverse .navbar-nav > .active > a, | ||
| + | .navbar-inverse .navbar-nav > .active > a:hover, | ||
| + | .navbar-inverse .navbar-nav > .active > a:focus { | ||
| + | color: #fff; | ||
| + | background-color: #080808; | ||
| + | } | ||
| + | .navbar-inverse .navbar-nav > .disabled > a, | ||
| + | .navbar-inverse .navbar-nav > .disabled > a:hover, | ||
| + | .navbar-inverse .navbar-nav > .disabled > a:focus { | ||
| + | color: #444; | ||
| + | background-color: transparent; | ||
| + | } | ||
| + | .navbar-inverse .navbar-nav > .open > a, | ||
| + | .navbar-inverse .navbar-nav > .open > a:hover, | ||
| + | .navbar-inverse .navbar-nav > .open > a:focus { | ||
| + | color: #fff; | ||
| + | background-color: #080808; | ||
| + | } | ||
| + | @media (max-width: 767px) { | ||
| + | .navbar-inverse .navbar-nav .open .dropdown-menu > .dropdown-header { | ||
| + | border-color: #080808; | ||
| + | } | ||
| + | .navbar-inverse .navbar-nav .open .dropdown-menu .divider { | ||
| + | background-color: #080808; | ||
| + | } | ||
| + | .navbar-inverse .navbar-nav .open .dropdown-menu > li > a { | ||
| + | color: #9d9d9d; | ||
| + | } | ||
| + | .navbar-inverse .navbar-nav .open .dropdown-menu > li > a:hover, | ||
| + | .navbar-inverse .navbar-nav .open .dropdown-menu > li > a:focus { | ||
| + | color: #fff; | ||
| + | background-color: transparent; | ||
| + | } | ||
| + | .navbar-inverse .navbar-nav .open .dropdown-menu > .active > a, | ||
| + | .navbar-inverse .navbar-nav .open .dropdown-menu > .active > a:hover, | ||
| + | .navbar-inverse .navbar-nav .open .dropdown-menu > .active > a:focus { | ||
| + | color: #fff; | ||
| + | background-color: #080808; | ||
| + | } | ||
| + | .navbar-inverse .navbar-nav .open .dropdown-menu > .disabled > a, | ||
| + | .navbar-inverse .navbar-nav .open .dropdown-menu > .disabled > a:hover, | ||
| + | .navbar-inverse .navbar-nav .open .dropdown-menu > .disabled > a:focus { | ||
| + | color: #444; | ||
| + | background-color: transparent; | ||
| + | } | ||
| + | } | ||
| + | .navbar-inverse .navbar-toggle { | ||
| + | border-color: #333; | ||
| + | } | ||
| + | .navbar-inverse .navbar-toggle:hover, | ||
| + | .navbar-inverse .navbar-toggle:focus { | ||
| + | background-color: #333; | ||
| + | } | ||
| + | .navbar-inverse .navbar-toggle .icon-bar { | ||
| + | background-color: #fff; | ||
| + | } | ||
| + | .navbar-inverse .navbar-collapse, | ||
| + | .navbar-inverse .navbar-form { | ||
| + | border-color: #101010; | ||
| + | } | ||
| + | .navbar-inverse .navbar-link { | ||
| + | color: #9d9d9d; | ||
| + | } | ||
| + | .navbar-inverse .navbar-link:hover { | ||
| + | color: #fff; | ||
| + | } | ||
| + | .navbar-inverse .btn-link { | ||
| + | color: #9d9d9d; | ||
| + | } | ||
| + | .navbar-inverse .btn-link:hover, | ||
| + | .navbar-inverse .btn-link:focus { | ||
| + | color: #fff; | ||
| + | } | ||
| + | .navbar-inverse .btn-link[disabled]:hover, | ||
| + | fieldset[disabled] .navbar-inverse .btn-link:hover, | ||
| + | .navbar-inverse .btn-link[disabled]:focus, | ||
| + | fieldset[disabled] .navbar-inverse .btn-link:focus { | ||
| + | color: #444; | ||
| + | } | ||
| + | .breadcrumb { | ||
| + | padding: 8px 15px; | ||
| + | margin-bottom: 20px; | ||
| + | list-style: none; | ||
| + | background-color: #f5f5f5; | ||
| + | border-radius: 4px; | ||
| + | } | ||
| + | .breadcrumb > li { | ||
| + | display: inline-block; | ||
| + | } | ||
| + | .breadcrumb > li + li:before { | ||
| + | padding: 0 5px; | ||
| + | color: #ccc; | ||
| + | content: "/\00a0"; | ||
| + | } | ||
| + | .breadcrumb > .active { | ||
| + | color: #777777; | ||
| + | } | ||
| + | .pagination { | ||
| + | display: inline-block; | ||
| + | padding-left: 0; | ||
| + | margin: 20px 0; | ||
| + | border-radius: 4px; | ||
| + | } | ||
| + | .pagination > li { | ||
| + | display: inline; | ||
| + | } | ||
| + | .pagination > li > a, | ||
| + | .pagination > li > span { | ||
| + | position: relative; | ||
| + | float: left; | ||
| + | padding: 6px 12px; | ||
| + | margin-left: -1px; | ||
| + | line-height: 1.42857143; | ||
| + | color: #337ab7; | ||
| + | text-decoration: none; | ||
| + | background-color: #fff; | ||
| + | border: 1px solid #ddd; | ||
| + | } | ||
| + | .pagination > li > a:hover, | ||
| + | .pagination > li > span:hover, | ||
| + | .pagination > li > a:focus, | ||
| + | .pagination > li > span:focus { | ||
| + | z-index: 2; | ||
| + | color: #23527c; | ||
| + | background-color: #eeeeee; | ||
| + | border-color: #ddd; | ||
| + | } | ||
| + | .pagination > li:first-child > a, | ||
| + | .pagination > li:first-child > span { | ||
| + | margin-left: 0; | ||
| + | border-top-left-radius: 4px; | ||
| + | border-bottom-left-radius: 4px; | ||
| + | } | ||
| + | .pagination > li:last-child > a, | ||
| + | .pagination > li:last-child > span { | ||
| + | border-top-right-radius: 4px; | ||
| + | border-bottom-right-radius: 4px; | ||
| + | } | ||
| + | .pagination > .active > a, | ||
| + | .pagination > .active > span, | ||
| + | .pagination > .active > a:hover, | ||
| + | .pagination > .active > span:hover, | ||
| + | .pagination > .active > a:focus, | ||
| + | .pagination > .active > span:focus { | ||
| + | z-index: 3; | ||
| + | color: #fff; | ||
| + | cursor: default; | ||
| + | background-color: #337ab7; | ||
| + | border-color: #337ab7; | ||
| + | } | ||
| + | .pagination > .disabled > span, | ||
| + | .pagination > .disabled > span:hover, | ||
| + | .pagination > .disabled > span:focus, | ||
| + | .pagination > .disabled > a, | ||
| + | .pagination > .disabled > a:hover, | ||
| + | .pagination > .disabled > a:focus { | ||
| + | color: #777777; | ||
| + | cursor: not-allowed; | ||
| + | background-color: #fff; | ||
| + | border-color: #ddd; | ||
| + | } | ||
| + | .pagination-lg > li > a, | ||
| + | .pagination-lg > li > span { | ||
| + | padding: 10px 16px; | ||
| + | font-size: 18px; | ||
| + | line-height: 1.3333333; | ||
| + | } | ||
| + | .pagination-lg > li:first-child > a, | ||
| + | .pagination-lg > li:first-child > span { | ||
| + | border-top-left-radius: 6px; | ||
| + | border-bottom-left-radius: 6px; | ||
| + | } | ||
| + | .pagination-lg > li:last-child > a, | ||
| + | .pagination-lg > li:last-child > span { | ||
| + | border-top-right-radius: 6px; | ||
| + | border-bottom-right-radius: 6px; | ||
| + | } | ||
| + | .pagination-sm > li > a, | ||
| + | .pagination-sm > li > span { | ||
| + | padding: 5px 10px; | ||
| + | font-size: 12px; | ||
| + | line-height: 1.5; | ||
| + | } | ||
| + | .pagination-sm > li:first-child > a, | ||
| + | .pagination-sm > li:first-child > span { | ||
| + | border-top-left-radius: 3px; | ||
| + | border-bottom-left-radius: 3px; | ||
| + | } | ||
| + | .pagination-sm > li:last-child > a, | ||
| + | .pagination-sm > li:last-child > span { | ||
| + | border-top-right-radius: 3px; | ||
| + | border-bottom-right-radius: 3px; | ||
| + | } | ||
| + | .pager { | ||
| + | padding-left: 0; | ||
| + | margin: 20px 0; | ||
| + | text-align: center; | ||
| + | list-style: none; | ||
| + | } | ||
| + | .pager li { | ||
| + | display: inline; | ||
| + | } | ||
| + | .pager li > a, | ||
| + | .pager li > span { | ||
| + | display: inline-block; | ||
| + | padding: 5px 14px; | ||
| + | background-color: #fff; | ||
| + | border: 1px solid #ddd; | ||
| + | border-radius: 15px; | ||
| + | } | ||
| + | .pager li > a:hover, | ||
| + | .pager li > a:focus { | ||
| + | text-decoration: none; | ||
| + | background-color: #eeeeee; | ||
| + | } | ||
| + | .pager .next > a, | ||
| + | .pager .next > span { | ||
| + | float: right; | ||
| + | } | ||
| + | .pager .previous > a, | ||
| + | .pager .previous > span { | ||
| + | float: left; | ||
| + | } | ||
| + | .pager .disabled > a, | ||
| + | .pager .disabled > a:hover, | ||
| + | .pager .disabled > a:focus, | ||
| + | .pager .disabled > span { | ||
| + | color: #777777; | ||
| + | cursor: not-allowed; | ||
| + | background-color: #fff; | ||
| + | } | ||
| + | .label { | ||
| + | display: inline; | ||
| + | padding: 0.2em 0.6em 0.3em; | ||
| + | font-size: 75%; | ||
| + | font-weight: 700; | ||
| + | line-height: 1; | ||
| + | color: #fff; | ||
| + | text-align: center; | ||
| + | white-space: nowrap; | ||
| + | vertical-align: baseline; | ||
| + | border-radius: 0.25em; | ||
| + | } | ||
| + | a.label:hover, | ||
| + | a.label:focus { | ||
| + | color: #fff; | ||
| + | text-decoration: none; | ||
| + | cursor: pointer; | ||
| + | } | ||
| + | .label:empty { | ||
| + | display: none; | ||
| + | } | ||
| + | .btn .label { | ||
| + | position: relative; | ||
| + | top: -1px; | ||
| + | } | ||
| + | .label-default { | ||
| + | background-color: #777777; | ||
| + | } | ||
| + | .label-default[href]:hover, | ||
| + | .label-default[href]:focus { | ||
| + | background-color: #5e5e5e; | ||
| + | } | ||
| + | .label-primary { | ||
| + | background-color: #337ab7; | ||
| + | } | ||
| + | .label-primary[href]:hover, | ||
| + | .label-primary[href]:focus { | ||
| + | background-color: #286090; | ||
| + | } | ||
| + | .label-success { | ||
| + | background-color: #5cb85c; | ||
| + | } | ||
| + | .label-success[href]:hover, | ||
| + | .label-success[href]:focus { | ||
| + | background-color: #449d44; | ||
| + | } | ||
| + | .label-info { | ||
| + | background-color: #5bc0de; | ||
| + | } | ||
| + | .label-info[href]:hover, | ||
| + | .label-info[href]:focus { | ||
| + | background-color: #31b0d5; | ||
| + | } | ||
| + | .label-warning { | ||
| + | background-color: #f0ad4e; | ||
| + | } | ||
| + | .label-warning[href]:hover, | ||
| + | .label-warning[href]:focus { | ||
| + | background-color: #ec971f; | ||
| + | } | ||
| + | .label-danger { | ||
| + | background-color: #d9534f; | ||
| + | } | ||
| + | .label-danger[href]:hover, | ||
| + | .label-danger[href]:focus { | ||
| + | background-color: #c9302c; | ||
| + | } | ||
| + | .badge { | ||
| + | display: inline-block; | ||
| + | min-width: 10px; | ||
| + | padding: 3px 7px; | ||
| + | font-size: 12px; | ||
| + | font-weight: bold; | ||
| + | line-height: 1; | ||
| + | color: #fff; | ||
| + | text-align: center; | ||
| + | white-space: nowrap; | ||
| + | vertical-align: middle; | ||
| + | background-color: #777777; | ||
| + | border-radius: 10px; | ||
| + | } | ||
| + | .badge:empty { | ||
| + | display: none; | ||
| + | } | ||
| + | .btn .badge { | ||
| + | position: relative; | ||
| + | top: -1px; | ||
| + | } | ||
| + | .btn-xs .badge, | ||
| + | .btn-group-xs > .btn .badge { | ||
| + | top: 0; | ||
| + | padding: 1px 5px; | ||
| + | } | ||
| + | a.badge:hover, | ||
| + | a.badge:focus { | ||
| + | color: #fff; | ||
| + | text-decoration: none; | ||
| + | cursor: pointer; | ||
| + | } | ||
| + | .list-group-item.active > .badge, | ||
| + | .nav-pills > .active > a > .badge { | ||
| + | color: #337ab7; | ||
| + | background-color: #fff; | ||
| + | } | ||
| + | .list-group-item > .badge { | ||
| + | float: right; | ||
| + | } | ||
| + | .list-group-item > .badge + .badge { | ||
| + | margin-right: 5px; | ||
| + | } | ||
| + | .nav-pills > li > a > .badge { | ||
| + | margin-left: 3px; | ||
| + | } | ||
| + | .jumbotron { | ||
| + | padding-top: 30px; | ||
| + | padding-bottom: 30px; | ||
| + | margin-bottom: 30px; | ||
| + | color: inherit; | ||
| + | background-color: #eeeeee; | ||
| + | } | ||
| + | .jumbotron h1, | ||
| + | .jumbotron .h1 { | ||
| + | color: inherit; | ||
| + | } | ||
| + | .jumbotron p { | ||
| + | margin-bottom: 15px; | ||
| + | font-size: 21px; | ||
| + | font-weight: 200; | ||
| + | } | ||
| + | .jumbotron > hr { | ||
| + | border-top-color: #d5d5d5; | ||
| + | } | ||
| + | .container .jumbotron, | ||
| + | .container-fluid .jumbotron { | ||
| + | padding-right: 15px; | ||
| + | padding-left: 15px; | ||
| + | border-radius: 6px; | ||
| + | } | ||
| + | .jumbotron .container { | ||
| + | max-width: 100%; | ||
| + | } | ||
| + | @media screen and (min-width: 768px) { | ||
| + | .jumbotron { | ||
| + | padding-top: 48px; | ||
| + | padding-bottom: 48px; | ||
| + | } | ||
| + | .container .jumbotron, | ||
| + | .container-fluid .jumbotron { | ||
| + | padding-right: 60px; | ||
| + | padding-left: 60px; | ||
| + | } | ||
| + | .jumbotron h1, | ||
| + | .jumbotron .h1 { | ||
| + | font-size: 63px; | ||
| + | } | ||
| + | } | ||
| + | .thumbnail { | ||
| + | display: block; | ||
| + | padding: 4px; | ||
| + | margin-bottom: 20px; | ||
| + | line-height: 1.42857143; | ||
| + | background-color: #fff; | ||
| + | border: 1px solid #ddd; | ||
| + | border-radius: 4px; | ||
| + | -webkit-transition: border 0.2s ease-in-out; | ||
| + | -o-transition: border 0.2s ease-in-out; | ||
| + | transition: border 0.2s ease-in-out; | ||
| + | } | ||
| + | .thumbnail > img, | ||
| + | .thumbnail a > img { | ||
| + | margin-right: auto; | ||
| + | margin-left: auto; | ||
| + | } | ||
| + | a.thumbnail:hover, | ||
| + | a.thumbnail:focus, | ||
| + | a.thumbnail.active { | ||
| + | border-color: #337ab7; | ||
| + | } | ||
| + | .thumbnail .caption { | ||
| + | padding: 9px; | ||
| + | color: #333333; | ||
| + | } | ||
| + | .alert { | ||
| + | padding: 15px; | ||
| + | margin-bottom: 20px; | ||
| + | border: 1px solid transparent; | ||
| + | border-radius: 4px; | ||
| + | } | ||
| + | .alert h4 { | ||
| + | margin-top: 0; | ||
| + | color: inherit; | ||
| + | } | ||
| + | .alert .alert-link { | ||
| + | font-weight: bold; | ||
| + | } | ||
| + | .alert > p, | ||
| + | .alert > ul { | ||
| + | margin-bottom: 0; | ||
| + | } | ||
| + | .alert > p + p { | ||
| + | margin-top: 5px; | ||
| + | } | ||
| + | .alert-dismissable, | ||
| + | .alert-dismissible { | ||
| + | padding-right: 35px; | ||
| + | } | ||
| + | .alert-dismissable .close, | ||
| + | .alert-dismissible .close { | ||
| + | position: relative; | ||
| + | top: -2px; | ||
| + | right: -21px; | ||
| + | color: inherit; | ||
| + | } | ||
| + | .alert-success { | ||
| + | color: #3c763d; | ||
| + | background-color: #dff0d8; | ||
| + | border-color: #d6e9c6; | ||
| + | } | ||
| + | .alert-success hr { | ||
| + | border-top-color: #c9e2b3; | ||
| + | } | ||
| + | .alert-success .alert-link { | ||
| + | color: #2b542c; | ||
| + | } | ||
| + | .alert-info { | ||
| + | color: #31708f; | ||
| + | background-color: #d9edf7; | ||
| + | border-color: #bce8f1; | ||
| + | } | ||
| + | .alert-info hr { | ||
| + | border-top-color: #a6e1ec; | ||
| + | } | ||
| + | .alert-info .alert-link { | ||
| + | color: #245269; | ||
| + | } | ||
| + | .alert-warning { | ||
| + | color: #8a6d3b; | ||
| + | background-color: #fcf8e3; | ||
| + | border-color: #faebcc; | ||
| + | } | ||
| + | .alert-warning hr { | ||
| + | border-top-color: #f7e1b5; | ||
| + | } | ||
| + | .alert-warning .alert-link { | ||
| + | color: #66512c; | ||
| + | } | ||
| + | .alert-danger { | ||
| + | color: #a94442; | ||
| + | background-color: #f2dede; | ||
| + | border-color: #ebccd1; | ||
| + | } | ||
| + | .alert-danger hr { | ||
| + | border-top-color: #e4b9c0; | ||
| + | } | ||
| + | .alert-danger .alert-link { | ||
| + | color: #843534; | ||
| + | } | ||
| + | @-webkit-keyframes progress-bar-stripes { | ||
| + | from { | ||
| + | background-position: 40px 0; | ||
| + | } | ||
| + | to { | ||
| + | background-position: 0 0; | ||
| + | } | ||
| + | } | ||
| + | @-o-keyframes progress-bar-stripes { | ||
| + | from { | ||
| + | background-position: 40px 0; | ||
| + | } | ||
| + | to { | ||
| + | background-position: 0 0; | ||
| + | } | ||
| + | } | ||
| + | @keyframes progress-bar-stripes { | ||
| + | from { | ||
| + | background-position: 40px 0; | ||
| + | } | ||
| + | to { | ||
| + | background-position: 0 0; | ||
| + | } | ||
| + | } | ||
| + | .progress { | ||
| + | height: 20px; | ||
| + | margin-bottom: 20px; | ||
| + | overflow: hidden; | ||
| + | background-color: #f5f5f5; | ||
| + | border-radius: 4px; | ||
| + | -webkit-box-shadow: inset 0 1px 2px rgba(0, 0, 0, 0.1); | ||
| + | box-shadow: inset 0 1px 2px rgba(0, 0, 0, 0.1); | ||
| + | } | ||
| + | .progress-bar { | ||
| + | float: left; | ||
| + | width: 0%; | ||
| + | height: 100%; | ||
| + | font-size: 12px; | ||
| + | line-height: 20px; | ||
| + | color: #fff; | ||
| + | text-align: center; | ||
| + | background-color: #337ab7; | ||
| + | -webkit-box-shadow: inset 0 -1px 0 rgba(0, 0, 0, 0.15); | ||
| + | box-shadow: inset 0 -1px 0 rgba(0, 0, 0, 0.15); | ||
| + | -webkit-transition: width 0.6s ease; | ||
| + | -o-transition: width 0.6s ease; | ||
| + | transition: width 0.6s ease; | ||
| + | } | ||
| + | .progress-striped .progress-bar, | ||
| + | .progress-bar-striped { | ||
| + | background-image: -webkit-linear-gradient(45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent); | ||
| + | background-image: -o-linear-gradient(45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent); | ||
| + | background-image: linear-gradient(45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent); | ||
| + | -webkit-background-size: 40px 40px; | ||
| + | background-size: 40px 40px; | ||
| + | } | ||
| + | .progress.active .progress-bar, | ||
| + | .progress-bar.active { | ||
| + | -webkit-animation: progress-bar-stripes 2s linear infinite; | ||
| + | -o-animation: progress-bar-stripes 2s linear infinite; | ||
| + | animation: progress-bar-stripes 2s linear infinite; | ||
| + | } | ||
| + | .progress-bar-success { | ||
| + | background-color: #5cb85c; | ||
| + | } | ||
| + | .progress-striped .progress-bar-success { | ||
| + | background-image: -webkit-linear-gradient(45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent); | ||
| + | background-image: -o-linear-gradient(45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent); | ||
| + | background-image: linear-gradient(45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent); | ||
| + | } | ||
| + | .progress-bar-info { | ||
| + | background-color: #5bc0de; | ||
| + | } | ||
| + | .progress-striped .progress-bar-info { | ||
| + | background-image: -webkit-linear-gradient(45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent); | ||
| + | background-image: -o-linear-gradient(45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent); | ||
| + | background-image: linear-gradient(45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent); | ||
| + | } | ||
| + | .progress-bar-warning { | ||
| + | background-color: #f0ad4e; | ||
| + | } | ||
| + | .progress-striped .progress-bar-warning { | ||
| + | background-image: -webkit-linear-gradient(45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent); | ||
| + | background-image: -o-linear-gradient(45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent); | ||
| + | background-image: linear-gradient(45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent); | ||
| + | } | ||
| + | .progress-bar-danger { | ||
| + | background-color: #d9534f; | ||
| + | } | ||
| + | .progress-striped .progress-bar-danger { | ||
| + | background-image: -webkit-linear-gradient(45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent); | ||
| + | background-image: -o-linear-gradient(45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent); | ||
| + | background-image: linear-gradient(45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent); | ||
| + | } | ||
| + | .media { | ||
| + | margin-top: 15px; | ||
| + | } | ||
| + | .media:first-child { | ||
| + | margin-top: 0; | ||
| + | } | ||
| + | .media, | ||
| + | .media-body { | ||
| + | overflow: hidden; | ||
| + | zoom: 1; | ||
| + | } | ||
| + | .media-body { | ||
| + | width: 10000px; | ||
| + | } | ||
| + | .media-object { | ||
| + | display: block; | ||
| + | } | ||
| + | .media-object.img-thumbnail { | ||
| + | max-width: none; | ||
| + | } | ||
| + | .media-right, | ||
| + | .media > .pull-right { | ||
| + | padding-left: 10px; | ||
| + | } | ||
| + | .media-left, | ||
| + | .media > .pull-left { | ||
| + | padding-right: 10px; | ||
| + | } | ||
| + | .media-left, | ||
| + | .media-right, | ||
| + | .media-body { | ||
| + | display: table-cell; | ||
| + | vertical-align: top; | ||
| + | } | ||
| + | .media-middle { | ||
| + | vertical-align: middle; | ||
| + | } | ||
| + | .media-bottom { | ||
| + | vertical-align: bottom; | ||
| + | } | ||
| + | .media-heading { | ||
| + | margin-top: 0; | ||
| + | margin-bottom: 5px; | ||
| + | } | ||
| + | .media-list { | ||
| + | padding-left: 0; | ||
| + | list-style: none; | ||
| + | } | ||
| + | .list-group { | ||
| + | padding-left: 0; | ||
| + | margin-bottom: 20px; | ||
| + | } | ||
| + | .list-group-item { | ||
| + | position: relative; | ||
| + | display: block; | ||
| + | padding: 10px 15px; | ||
| + | margin-bottom: -1px; | ||
| + | background-color: #fff; | ||
| + | border: 1px solid #ddd; | ||
| + | } | ||
| + | .list-group-item:first-child { | ||
| + | border-top-left-radius: 4px; | ||
| + | border-top-right-radius: 4px; | ||
| + | } | ||
| + | .list-group-item:last-child { | ||
| + | margin-bottom: 0; | ||
| + | border-bottom-right-radius: 4px; | ||
| + | border-bottom-left-radius: 4px; | ||
| + | } | ||
| + | .list-group-item.disabled, | ||
| + | .list-group-item.disabled:hover, | ||
| + | .list-group-item.disabled:focus { | ||
| + | color: #777777; | ||
| + | cursor: not-allowed; | ||
| + | background-color: #eeeeee; | ||
| + | } | ||
| + | .list-group-item.disabled .list-group-item-heading, | ||
| + | .list-group-item.disabled:hover .list-group-item-heading, | ||
| + | .list-group-item.disabled:focus .list-group-item-heading { | ||
| + | color: inherit; | ||
| + | } | ||
| + | .list-group-item.disabled .list-group-item-text, | ||
| + | .list-group-item.disabled:hover .list-group-item-text, | ||
| + | .list-group-item.disabled:focus .list-group-item-text { | ||
| + | color: #777777; | ||
| + | } | ||
| + | .list-group-item.active, | ||
| + | .list-group-item.active:hover, | ||
| + | .list-group-item.active:focus { | ||
| + | z-index: 2; | ||
| + | color: #fff; | ||
| + | background-color: #337ab7; | ||
| + | border-color: #337ab7; | ||
| + | } | ||
| + | .list-group-item.active .list-group-item-heading, | ||
| + | .list-group-item.active:hover .list-group-item-heading, | ||
| + | .list-group-item.active:focus .list-group-item-heading, | ||
| + | .list-group-item.active .list-group-item-heading > small, | ||
| + | .list-group-item.active:hover .list-group-item-heading > small, | ||
| + | .list-group-item.active:focus .list-group-item-heading > small, | ||
| + | .list-group-item.active .list-group-item-heading > .small, | ||
| + | .list-group-item.active:hover .list-group-item-heading > .small, | ||
| + | .list-group-item.active:focus .list-group-item-heading > .small { | ||
| + | color: inherit; | ||
| + | } | ||
| + | .list-group-item.active .list-group-item-text, | ||
| + | .list-group-item.active:hover .list-group-item-text, | ||
| + | .list-group-item.active:focus .list-group-item-text { | ||
| + | color: #c7ddef; | ||
| + | } | ||
| + | a.list-group-item, | ||
| + | button.list-group-item { | ||
| + | color: #555; | ||
| + | } | ||
| + | a.list-group-item .list-group-item-heading, | ||
| + | button.list-group-item .list-group-item-heading { | ||
| + | color: #333; | ||
| + | } | ||
| + | a.list-group-item:hover, | ||
| + | button.list-group-item:hover, | ||
| + | a.list-group-item:focus, | ||
| + | button.list-group-item:focus { | ||
| + | color: #555; | ||
| + | text-decoration: none; | ||
| + | background-color: #f5f5f5; | ||
| + | } | ||
| + | button.list-group-item { | ||
| + | width: 100%; | ||
| + | text-align: left; | ||
| + | } | ||
| + | .list-group-item-success { | ||
| + | color: #3c763d; | ||
| + | background-color: #dff0d8; | ||
| + | } | ||
| + | a.list-group-item-success, | ||
| + | button.list-group-item-success { | ||
| + | color: #3c763d; | ||
| + | } | ||
| + | a.list-group-item-success .list-group-item-heading, | ||
| + | button.list-group-item-success .list-group-item-heading { | ||
| + | color: inherit; | ||
| + | } | ||
| + | a.list-group-item-success:hover, | ||
| + | button.list-group-item-success:hover, | ||
| + | a.list-group-item-success:focus, | ||
| + | button.list-group-item-success:focus { | ||
| + | color: #3c763d; | ||
| + | background-color: #d0e9c6; | ||
| + | } | ||
| + | a.list-group-item-success.active, | ||
| + | button.list-group-item-success.active, | ||
| + | a.list-group-item-success.active:hover, | ||
| + | button.list-group-item-success.active:hover, | ||
| + | a.list-group-item-success.active:focus, | ||
| + | button.list-group-item-success.active:focus { | ||
| + | color: #fff; | ||
| + | background-color: #3c763d; | ||
| + | border-color: #3c763d; | ||
| + | } | ||
| + | .list-group-item-info { | ||
| + | color: #31708f; | ||
| + | background-color: #d9edf7; | ||
| + | } | ||
| + | a.list-group-item-info, | ||
| + | button.list-group-item-info { | ||
| + | color: #31708f; | ||
| + | } | ||
| + | a.list-group-item-info .list-group-item-heading, | ||
| + | button.list-group-item-info .list-group-item-heading { | ||
| + | color: inherit; | ||
| + | } | ||
| + | a.list-group-item-info:hover, | ||
| + | button.list-group-item-info:hover, | ||
| + | a.list-group-item-info:focus, | ||
| + | button.list-group-item-info:focus { | ||
| + | color: #31708f; | ||
| + | background-color: #c4e3f3; | ||
| + | } | ||
| + | a.list-group-item-info.active, | ||
| + | button.list-group-item-info.active, | ||
| + | a.list-group-item-info.active:hover, | ||
| + | button.list-group-item-info.active:hover, | ||
| + | a.list-group-item-info.active:focus, | ||
| + | button.list-group-item-info.active:focus { | ||
| + | color: #fff; | ||
| + | background-color: #31708f; | ||
| + | border-color: #31708f; | ||
| + | } | ||
| + | .list-group-item-warning { | ||
| + | color: #8a6d3b; | ||
| + | background-color: #fcf8e3; | ||
| + | } | ||
| + | a.list-group-item-warning, | ||
| + | button.list-group-item-warning { | ||
| + | color: #8a6d3b; | ||
| + | } | ||
| + | a.list-group-item-warning .list-group-item-heading, | ||
| + | button.list-group-item-warning .list-group-item-heading { | ||
| + | color: inherit; | ||
| + | } | ||
| + | a.list-group-item-warning:hover, | ||
| + | button.list-group-item-warning:hover, | ||
| + | a.list-group-item-warning:focus, | ||
| + | button.list-group-item-warning:focus { | ||
| + | color: #8a6d3b; | ||
| + | background-color: #faf2cc; | ||
| + | } | ||
| + | a.list-group-item-warning.active, | ||
| + | button.list-group-item-warning.active, | ||
| + | a.list-group-item-warning.active:hover, | ||
| + | button.list-group-item-warning.active:hover, | ||
| + | a.list-group-item-warning.active:focus, | ||
| + | button.list-group-item-warning.active:focus { | ||
| + | color: #fff; | ||
| + | background-color: #8a6d3b; | ||
| + | border-color: #8a6d3b; | ||
| + | } | ||
| + | .list-group-item-danger { | ||
| + | color: #a94442; | ||
| + | background-color: #f2dede; | ||
| + | } | ||
| + | a.list-group-item-danger, | ||
| + | button.list-group-item-danger { | ||
| + | color: #a94442; | ||
| + | } | ||
| + | a.list-group-item-danger .list-group-item-heading, | ||
| + | button.list-group-item-danger .list-group-item-heading { | ||
| + | color: inherit; | ||
| + | } | ||
| + | a.list-group-item-danger:hover, | ||
| + | button.list-group-item-danger:hover, | ||
| + | a.list-group-item-danger:focus, | ||
| + | button.list-group-item-danger:focus { | ||
| + | color: #a94442; | ||
| + | background-color: #ebcccc; | ||
| + | } | ||
| + | a.list-group-item-danger.active, | ||
| + | button.list-group-item-danger.active, | ||
| + | a.list-group-item-danger.active:hover, | ||
| + | button.list-group-item-danger.active:hover, | ||
| + | a.list-group-item-danger.active:focus, | ||
| + | button.list-group-item-danger.active:focus { | ||
| + | color: #fff; | ||
| + | background-color: #a94442; | ||
| + | border-color: #a94442; | ||
| + | } | ||
| + | .list-group-item-heading { | ||
| + | margin-top: 0; | ||
| + | margin-bottom: 5px; | ||
| + | } | ||
| + | .list-group-item-text { | ||
| + | margin-bottom: 0; | ||
| + | line-height: 1.3; | ||
| + | } | ||
| + | .panel { | ||
| + | margin-bottom: 20px; | ||
| + | background-color: #fff; | ||
| + | border: 1px solid transparent; | ||
| + | border-radius: 4px; | ||
| + | -webkit-box-shadow: 0 1px 1px rgba(0, 0, 0, 0.05); | ||
| + | box-shadow: 0 1px 1px rgba(0, 0, 0, 0.05); | ||
| + | } | ||
| + | .panel-body { | ||
| + | padding: 15px; | ||
| + | } | ||
| + | .panel-heading { | ||
| + | padding: 10px 15px; | ||
| + | border-bottom: 1px solid transparent; | ||
| + | border-top-left-radius: 3px; | ||
| + | border-top-right-radius: 3px; | ||
| + | } | ||
| + | .panel-heading > .dropdown .dropdown-toggle { | ||
| + | color: inherit; | ||
| + | } | ||
| + | .panel-title { | ||
| + | margin-top: 0; | ||
| + | margin-bottom: 0; | ||
| + | font-size: 16px; | ||
| + | color: inherit; | ||
| + | } | ||
| + | .panel-title > a, | ||
| + | .panel-title > small, | ||
| + | .panel-title > .small, | ||
| + | .panel-title > small > a, | ||
| + | .panel-title > .small > a { | ||
| + | color: inherit; | ||
| + | } | ||
| + | .panel-footer { | ||
| + | padding: 10px 15px; | ||
| + | background-color: #f5f5f5; | ||
| + | border-top: 1px solid #ddd; | ||
| + | border-bottom-right-radius: 3px; | ||
| + | border-bottom-left-radius: 3px; | ||
| + | } | ||
| + | .panel > .list-group, | ||
| + | .panel > .panel-collapse > .list-group { | ||
| + | margin-bottom: 0; | ||
| + | } | ||
| + | .panel > .list-group .list-group-item, | ||
| + | .panel > .panel-collapse > .list-group .list-group-item { | ||
| + | border-width: 1px 0; | ||
| + | border-radius: 0; | ||
| + | } | ||
| + | .panel > .list-group:first-child .list-group-item:first-child, | ||
| + | .panel > .panel-collapse > .list-group:first-child .list-group-item:first-child { | ||
| + | border-top: 0; | ||
| + | border-top-left-radius: 3px; | ||
| + | border-top-right-radius: 3px; | ||
| + | } | ||
| + | .panel > .list-group:last-child .list-group-item:last-child, | ||
| + | .panel > .panel-collapse > .list-group:last-child .list-group-item:last-child { | ||
| + | border-bottom: 0; | ||
| + | border-bottom-right-radius: 3px; | ||
| + | border-bottom-left-radius: 3px; | ||
| + | } | ||
| + | .panel > .panel-heading + .panel-collapse > .list-group .list-group-item:first-child { | ||
| + | border-top-left-radius: 0; | ||
| + | border-top-right-radius: 0; | ||
| + | } | ||
| + | .panel-heading + .list-group .list-group-item:first-child { | ||
| + | border-top-width: 0; | ||
| + | } | ||
| + | .list-group + .panel-footer { | ||
| + | border-top-width: 0; | ||
| + | } | ||
| + | .panel > .table, | ||
| + | .panel > .table-responsive > .table, | ||
| + | .panel > .panel-collapse > .table { | ||
| + | margin-bottom: 0; | ||
| + | } | ||
| + | .panel > .table caption, | ||
| + | .panel > .table-responsive > .table caption, | ||
| + | .panel > .panel-collapse > .table caption { | ||
| + | padding-right: 15px; | ||
| + | padding-left: 15px; | ||
| + | } | ||
| + | .panel > .table:first-child, | ||
| + | .panel > .table-responsive:first-child > .table:first-child { | ||
| + | border-top-left-radius: 3px; | ||
| + | border-top-right-radius: 3px; | ||
| + | } | ||
| + | .panel > .table:first-child > thead:first-child > tr:first-child, | ||
| + | .panel > .table-responsive:first-child > .table:first-child > thead:first-child > tr:first-child, | ||
| + | .panel > .table:first-child > tbody:first-child > tr:first-child, | ||
| + | .panel > .table-responsive:first-child > .table:first-child > tbody:first-child > tr:first-child { | ||
| + | border-top-left-radius: 3px; | ||
| + | border-top-right-radius: 3px; | ||
| + | } | ||
| + | .panel > .table:first-child > thead:first-child > tr:first-child td:first-child, | ||
| + | .panel > .table-responsive:first-child > .table:first-child > thead:first-child > tr:first-child td:first-child, | ||
| + | .panel > .table:first-child > tbody:first-child > tr:first-child td:first-child, | ||
| + | .panel > .table-responsive:first-child > .table:first-child > tbody:first-child > tr:first-child td:first-child, | ||
| + | .panel > .table:first-child > thead:first-child > tr:first-child th:first-child, | ||
| + | .panel > .table-responsive:first-child > .table:first-child > thead:first-child > tr:first-child th:first-child, | ||
| + | .panel > .table:first-child > tbody:first-child > tr:first-child th:first-child, | ||
| + | .panel > .table-responsive:first-child > .table:first-child > tbody:first-child > tr:first-child th:first-child { | ||
| + | border-top-left-radius: 3px; | ||
| + | } | ||
| + | .panel > .table:first-child > thead:first-child > tr:first-child td:last-child, | ||
| + | .panel > .table-responsive:first-child > .table:first-child > thead:first-child > tr:first-child td:last-child, | ||
| + | .panel > .table:first-child > tbody:first-child > tr:first-child td:last-child, | ||
| + | .panel > .table-responsive:first-child > .table:first-child > tbody:first-child > tr:first-child td:last-child, | ||
| + | .panel > .table:first-child > thead:first-child > tr:first-child th:last-child, | ||
| + | .panel > .table-responsive:first-child > .table:first-child > thead:first-child > tr:first-child th:last-child, | ||
| + | .panel > .table:first-child > tbody:first-child > tr:first-child th:last-child, | ||
| + | .panel > .table-responsive:first-child > .table:first-child > tbody:first-child > tr:first-child th:last-child { | ||
| + | border-top-right-radius: 3px; | ||
| + | } | ||
| + | .panel > .table:last-child, | ||
| + | .panel > .table-responsive:last-child > .table:last-child { | ||
| + | border-bottom-right-radius: 3px; | ||
| + | border-bottom-left-radius: 3px; | ||
| + | } | ||
| + | .panel > .table:last-child > tbody:last-child > tr:last-child, | ||
| + | .panel > .table-responsive:last-child > .table:last-child > tbody:last-child > tr:last-child, | ||
| + | .panel > .table:last-child > tfoot:last-child > tr:last-child, | ||
| + | .panel > .table-responsive:last-child > .table:last-child > tfoot:last-child > tr:last-child { | ||
| + | border-bottom-right-radius: 3px; | ||
| + | border-bottom-left-radius: 3px; | ||
| + | } | ||
| + | .panel > .table:last-child > tbody:last-child > tr:last-child td:first-child, | ||
| + | .panel > .table-responsive:last-child > .table:last-child > tbody:last-child > tr:last-child td:first-child, | ||
| + | .panel > .table:last-child > tfoot:last-child > tr:last-child td:first-child, | ||
| + | .panel > .table-responsive:last-child > .table:last-child > tfoot:last-child > tr:last-child td:first-child, | ||
| + | .panel > .table:last-child > tbody:last-child > tr:last-child th:first-child, | ||
| + | .panel > .table-responsive:last-child > .table:last-child > tbody:last-child > tr:last-child th:first-child, | ||
| + | .panel > .table:last-child > tfoot:last-child > tr:last-child th:first-child, | ||
| + | .panel > .table-responsive:last-child > .table:last-child > tfoot:last-child > tr:last-child th:first-child { | ||
| + | border-bottom-left-radius: 3px; | ||
| + | } | ||
| + | .panel > .table:last-child > tbody:last-child > tr:last-child td:last-child, | ||
| + | .panel > .table-responsive:last-child > .table:last-child > tbody:last-child > tr:last-child td:last-child, | ||
| + | .panel > .table:last-child > tfoot:last-child > tr:last-child td:last-child, | ||
| + | .panel > .table-responsive:last-child > .table:last-child > tfoot:last-child > tr:last-child td:last-child, | ||
| + | .panel > .table:last-child > tbody:last-child > tr:last-child th:last-child, | ||
| + | .panel > .table-responsive:last-child > .table:last-child > tbody:last-child > tr:last-child th:last-child, | ||
| + | .panel > .table:last-child > tfoot:last-child > tr:last-child th:last-child, | ||
| + | .panel > .table-responsive:last-child > .table:last-child > tfoot:last-child > tr:last-child th:last-child { | ||
| + | border-bottom-right-radius: 3px; | ||
| + | } | ||
| + | .panel > .panel-body + .table, | ||
| + | .panel > .panel-body + .table-responsive, | ||
| + | .panel > .table + .panel-body, | ||
| + | .panel > .table-responsive + .panel-body { | ||
| + | border-top: 1px solid #ddd; | ||
| + | } | ||
| + | .panel > .table > tbody:first-child > tr:first-child th, | ||
| + | .panel > .table > tbody:first-child > tr:first-child td { | ||
| + | border-top: 0; | ||
| + | } | ||
| + | .panel > .table-bordered, | ||
| + | .panel > .table-responsive > .table-bordered { | ||
| + | border: 0; | ||
| + | } | ||
| + | .panel > .table-bordered > thead > tr > th:first-child, | ||
| + | .panel > .table-responsive > .table-bordered > thead > tr > th:first-child, | ||
| + | .panel > .table-bordered > tbody > tr > th:first-child, | ||
| + | .panel > .table-responsive > .table-bordered > tbody > tr > th:first-child, | ||
| + | .panel > .table-bordered > tfoot > tr > th:first-child, | ||
| + | .panel > .table-responsive > .table-bordered > tfoot > tr > th:first-child, | ||
| + | .panel > .table-bordered > thead > tr > td:first-child, | ||
| + | .panel > .table-responsive > .table-bordered > thead > tr > td:first-child, | ||
| + | .panel > .table-bordered > tbody > tr > td:first-child, | ||
| + | .panel > .table-responsive > .table-bordered > tbody > tr > td:first-child, | ||
| + | .panel > .table-bordered > tfoot > tr > td:first-child, | ||
| + | .panel > .table-responsive > .table-bordered > tfoot > tr > td:first-child { | ||
| + | border-left: 0; | ||
| + | } | ||
| + | .panel > .table-bordered > thead > tr > th:last-child, | ||
| + | .panel > .table-responsive > .table-bordered > thead > tr > th:last-child, | ||
| + | .panel > .table-bordered > tbody > tr > th:last-child, | ||
| + | .panel > .table-responsive > .table-bordered > tbody > tr > th:last-child, | ||
| + | .panel > .table-bordered > tfoot > tr > th:last-child, | ||
| + | .panel > .table-responsive > .table-bordered > tfoot > tr > th:last-child, | ||
| + | .panel > .table-bordered > thead > tr > td:last-child, | ||
| + | .panel > .table-responsive > .table-bordered > thead > tr > td:last-child, | ||
| + | .panel > .table-bordered > tbody > tr > td:last-child, | ||
| + | .panel > .table-responsive > .table-bordered > tbody > tr > td:last-child, | ||
| + | .panel > .table-bordered > tfoot > tr > td:last-child, | ||
| + | .panel > .table-responsive > .table-bordered > tfoot > tr > td:last-child { | ||
| + | border-right: 0; | ||
| + | } | ||
| + | .panel > .table-bordered > thead > tr:first-child > td, | ||
| + | .panel > .table-responsive > .table-bordered > thead > tr:first-child > td, | ||
| + | .panel > .table-bordered > tbody > tr:first-child > td, | ||
| + | .panel > .table-responsive > .table-bordered > tbody > tr:first-child > td, | ||
| + | .panel > .table-bordered > thead > tr:first-child > th, | ||
| + | .panel > .table-responsive > .table-bordered > thead > tr:first-child > th, | ||
| + | .panel > .table-bordered > tbody > tr:first-child > th, | ||
| + | .panel > .table-responsive > .table-bordered > tbody > tr:first-child > th { | ||
| + | border-bottom: 0; | ||
| + | } | ||
| + | .panel > .table-bordered > tbody > tr:last-child > td, | ||
| + | .panel > .table-responsive > .table-bordered > tbody > tr:last-child > td, | ||
| + | .panel > .table-bordered > tfoot > tr:last-child > td, | ||
| + | .panel > .table-responsive > .table-bordered > tfoot > tr:last-child > td, | ||
| + | .panel > .table-bordered > tbody > tr:last-child > th, | ||
| + | .panel > .table-responsive > .table-bordered > tbody > tr:last-child > th, | ||
| + | .panel > .table-bordered > tfoot > tr:last-child > th, | ||
| + | .panel > .table-responsive > .table-bordered > tfoot > tr:last-child > th { | ||
| + | border-bottom: 0; | ||
| + | } | ||
| + | .panel > .table-responsive { | ||
| + | margin-bottom: 0; | ||
| + | border: 0; | ||
| + | } | ||
| + | .panel-group { | ||
| + | margin-bottom: 20px; | ||
| + | } | ||
| + | .panel-group .panel { | ||
| + | margin-bottom: 0; | ||
| + | border-radius: 4px; | ||
| + | } | ||
| + | .panel-group .panel + .panel { | ||
| + | margin-top: 5px; | ||
| + | } | ||
| + | .panel-group .panel-heading { | ||
| + | border-bottom: 0; | ||
| + | } | ||
| + | .panel-group .panel-heading + .panel-collapse > .panel-body, | ||
| + | .panel-group .panel-heading + .panel-collapse > .list-group { | ||
| + | border-top: 1px solid #ddd; | ||
| + | } | ||
| + | .panel-group .panel-footer { | ||
| + | border-top: 0; | ||
| + | } | ||
| + | .panel-group .panel-footer + .panel-collapse .panel-body { | ||
| + | border-bottom: 1px solid #ddd; | ||
| + | } | ||
| + | .panel-default { | ||
| + | border-color: #ddd; | ||
| + | } | ||
| + | .panel-default > .panel-heading { | ||
| + | color: #333333; | ||
| + | background-color: #f5f5f5; | ||
| + | border-color: #ddd; | ||
| + | } | ||
| + | .panel-default > .panel-heading + .panel-collapse > .panel-body { | ||
| + | border-top-color: #ddd; | ||
| + | } | ||
| + | .panel-default > .panel-heading .badge { | ||
| + | color: #f5f5f5; | ||
| + | background-color: #333333; | ||
| + | } | ||
| + | .panel-default > .panel-footer + .panel-collapse > .panel-body { | ||
| + | border-bottom-color: #ddd; | ||
| + | } | ||
| + | .panel-primary { | ||
| + | border-color: #337ab7; | ||
| + | } | ||
| + | .panel-primary > .panel-heading { | ||
| + | color: #fff; | ||
| + | background-color: #337ab7; | ||
| + | border-color: #337ab7; | ||
| + | } | ||
| + | .panel-primary > .panel-heading + .panel-collapse > .panel-body { | ||
| + | border-top-color: #337ab7; | ||
| + | } | ||
| + | .panel-primary > .panel-heading .badge { | ||
| + | color: #337ab7; | ||
| + | background-color: #fff; | ||
| + | } | ||
| + | .panel-primary > .panel-footer + .panel-collapse > .panel-body { | ||
| + | border-bottom-color: #337ab7; | ||
| + | } | ||
| + | .panel-success { | ||
| + | border-color: #d6e9c6; | ||
| + | } | ||
| + | .panel-success > .panel-heading { | ||
| + | color: #3c763d; | ||
| + | background-color: #dff0d8; | ||
| + | border-color: #d6e9c6; | ||
| + | } | ||
| + | .panel-success > .panel-heading + .panel-collapse > .panel-body { | ||
| + | border-top-color: #d6e9c6; | ||
| + | } | ||
| + | .panel-success > .panel-heading .badge { | ||
| + | color: #dff0d8; | ||
| + | background-color: #3c763d; | ||
| + | } | ||
| + | .panel-success > .panel-footer + .panel-collapse > .panel-body { | ||
| + | border-bottom-color: #d6e9c6; | ||
| + | } | ||
| + | .panel-info { | ||
| + | border-color: #bce8f1; | ||
| + | } | ||
| + | .panel-info > .panel-heading { | ||
| + | color: #31708f; | ||
| + | background-color: #d9edf7; | ||
| + | border-color: #bce8f1; | ||
| + | } | ||
| + | .panel-info > .panel-heading + .panel-collapse > .panel-body { | ||
| + | border-top-color: #bce8f1; | ||
| + | } | ||
| + | .panel-info > .panel-heading .badge { | ||
| + | color: #d9edf7; | ||
| + | background-color: #31708f; | ||
| + | } | ||
| + | .panel-info > .panel-footer + .panel-collapse > .panel-body { | ||
| + | border-bottom-color: #bce8f1; | ||
| + | } | ||
| + | .panel-warning { | ||
| + | border-color: #faebcc; | ||
| + | } | ||
| + | .panel-warning > .panel-heading { | ||
| + | color: #8a6d3b; | ||
| + | background-color: #fcf8e3; | ||
| + | border-color: #faebcc; | ||
| + | } | ||
| + | .panel-warning > .panel-heading + .panel-collapse > .panel-body { | ||
| + | border-top-color: #faebcc; | ||
| + | } | ||
| + | .panel-warning > .panel-heading .badge { | ||
| + | color: #fcf8e3; | ||
| + | background-color: #8a6d3b; | ||
| + | } | ||
| + | .panel-warning > .panel-footer + .panel-collapse > .panel-body { | ||
| + | border-bottom-color: #faebcc; | ||
| + | } | ||
| + | .panel-danger { | ||
| + | border-color: #ebccd1; | ||
| + | } | ||
| + | .panel-danger > .panel-heading { | ||
| + | color: #a94442; | ||
| + | background-color: #f2dede; | ||
| + | border-color: #ebccd1; | ||
| + | } | ||
| + | .panel-danger > .panel-heading + .panel-collapse > .panel-body { | ||
| + | border-top-color: #ebccd1; | ||
| + | } | ||
| + | .panel-danger > .panel-heading .badge { | ||
| + | color: #f2dede; | ||
| + | background-color: #a94442; | ||
| + | } | ||
| + | .panel-danger > .panel-footer + .panel-collapse > .panel-body { | ||
| + | border-bottom-color: #ebccd1; | ||
| + | } | ||
| + | .embed-responsive { | ||
| + | position: relative; | ||
| + | display: block; | ||
| + | height: 0; | ||
| + | padding: 0; | ||
| + | overflow: hidden; | ||
| + | } | ||
| + | .embed-responsive .embed-responsive-item, | ||
| + | .embed-responsive iframe, | ||
| + | .embed-responsive embed, | ||
| + | .embed-responsive object, | ||
| + | .embed-responsive video { | ||
| + | position: absolute; | ||
| + | top: 0; | ||
| + | bottom: 0; | ||
| + | left: 0; | ||
| + | width: 100%; | ||
| + | height: 100%; | ||
| + | border: 0; | ||
| + | } | ||
| + | .embed-responsive-16by9 { | ||
| + | padding-bottom: 56.25%; | ||
| + | } | ||
| + | .embed-responsive-4by3 { | ||
| + | padding-bottom: 75%; | ||
| + | } | ||
| + | .well { | ||
| + | min-height: 20px; | ||
| + | padding: 19px; | ||
| + | margin-bottom: 20px; | ||
| + | background-color: #f5f5f5; | ||
| + | border: 1px solid #e3e3e3; | ||
| + | border-radius: 4px; | ||
| + | -webkit-box-shadow: inset 0 1px 1px rgba(0, 0, 0, 0.05); | ||
| + | box-shadow: inset 0 1px 1px rgba(0, 0, 0, 0.05); | ||
| + | } | ||
| + | .well blockquote { | ||
| + | border-color: #ddd; | ||
| + | border-color: rgba(0, 0, 0, 0.15); | ||
| + | } | ||
| + | .well-lg { | ||
| + | padding: 24px; | ||
| + | border-radius: 6px; | ||
| + | } | ||
| + | .well-sm { | ||
| + | padding: 9px; | ||
| + | border-radius: 3px; | ||
| + | } | ||
| + | .close { | ||
| + | float: right; | ||
| + | font-size: 21px; | ||
| + | font-weight: bold; | ||
| + | line-height: 1; | ||
| + | color: #000; | ||
| + | text-shadow: 0 1px 0 #fff; | ||
| + | filter: alpha(opacity=20); | ||
| + | opacity: 0.2; | ||
| + | } | ||
| + | .close:hover, | ||
| + | .close:focus { | ||
| + | color: #000; | ||
| + | text-decoration: none; | ||
| + | cursor: pointer; | ||
| + | filter: alpha(opacity=50); | ||
| + | opacity: 0.5; | ||
| + | } | ||
| + | button.close { | ||
| + | padding: 0; | ||
| + | cursor: pointer; | ||
| + | background: transparent; | ||
| + | border: 0; | ||
| + | -webkit-appearance: none; | ||
| + | -moz-appearance: none; | ||
| + | appearance: none; | ||
| + | } | ||
| + | .modal-open { | ||
| + | overflow: hidden; | ||
| + | } | ||
| + | .modal { | ||
| + | position: fixed; | ||
| + | top: 0; | ||
| + | right: 0; | ||
| + | bottom: 0; | ||
| + | left: 0; | ||
| + | z-index: 1050; | ||
| + | display: none; | ||
| + | overflow: hidden; | ||
| + | -webkit-overflow-scrolling: touch; | ||
| + | outline: 0; | ||
| + | } | ||
| + | .modal.fade .modal-dialog { | ||
| + | -webkit-transform: translate(0, -25%); | ||
| + | -ms-transform: translate(0, -25%); | ||
| + | -o-transform: translate(0, -25%); | ||
| + | transform: translate(0, -25%); | ||
| + | -webkit-transition: -webkit-transform 0.3s ease-out; | ||
| + | -o-transition: -o-transform 0.3s ease-out; | ||
| + | transition: -webkit-transform 0.3s ease-out; | ||
| + | transition: transform 0.3s ease-out; | ||
| + | transition: transform 0.3s ease-out, -webkit-transform 0.3s ease-out, -o-transform 0.3s ease-out; | ||
| + | } | ||
| + | .modal.in .modal-dialog { | ||
| + | -webkit-transform: translate(0, 0); | ||
| + | -ms-transform: translate(0, 0); | ||
| + | -o-transform: translate(0, 0); | ||
| + | transform: translate(0, 0); | ||
| + | } | ||
| + | .modal-open .modal { | ||
| + | overflow-x: hidden; | ||
| + | overflow-y: auto; | ||
| + | } | ||
| + | .modal-dialog { | ||
| + | position: relative; | ||
| + | width: auto; | ||
| + | margin: 10px; | ||
| + | } | ||
| + | .modal-content { | ||
| + | position: relative; | ||
| + | background-color: #fff; | ||
| + | background-clip: padding-box; | ||
| + | border: 1px solid #999; | ||
| + | border: 1px solid rgba(0, 0, 0, 0.2); | ||
| + | border-radius: 6px; | ||
| + | -webkit-box-shadow: 0 3px 9px rgba(0, 0, 0, 0.5); | ||
| + | box-shadow: 0 3px 9px rgba(0, 0, 0, 0.5); | ||
| + | outline: 0; | ||
| + | } | ||
| + | .modal-backdrop { | ||
| + | position: fixed; | ||
| + | top: 0; | ||
| + | right: 0; | ||
| + | bottom: 0; | ||
| + | left: 0; | ||
| + | z-index: 1040; | ||
| + | background-color: #000; | ||
| + | } | ||
| + | .modal-backdrop.fade { | ||
| + | filter: alpha(opacity=0); | ||
| + | opacity: 0; | ||
| + | } | ||
| + | .modal-backdrop.in { | ||
| + | filter: alpha(opacity=50); | ||
| + | opacity: 0.5; | ||
| + | } | ||
| + | .modal-header { | ||
| + | padding: 15px; | ||
| + | border-bottom: 1px solid #e5e5e5; | ||
| + | } | ||
| + | .modal-header .close { | ||
| + | margin-top: -2px; | ||
| + | } | ||
| + | .modal-title { | ||
| + | margin: 0; | ||
| + | line-height: 1.42857143; | ||
| + | } | ||
| + | .modal-body { | ||
| + | position: relative; | ||
| + | padding: 15px; | ||
| + | } | ||
| + | .modal-footer { | ||
| + | padding: 15px; | ||
| + | text-align: right; | ||
| + | border-top: 1px solid #e5e5e5; | ||
| + | } | ||
| + | .modal-footer .btn + .btn { | ||
| + | margin-bottom: 0; | ||
| + | margin-left: 5px; | ||
| + | } | ||
| + | .modal-footer .btn-group .btn + .btn { | ||
| + | margin-left: -1px; | ||
| + | } | ||
| + | .modal-footer .btn-block + .btn-block { | ||
| + | margin-left: 0; | ||
| + | } | ||
| + | .modal-scrollbar-measure { | ||
| + | position: absolute; | ||
| + | top: -9999px; | ||
| + | width: 50px; | ||
| + | height: 50px; | ||
| + | overflow: scroll; | ||
| + | } | ||
| + | @media (min-width: 768px) { | ||
| + | .modal-dialog { | ||
| + | width: 600px; | ||
| + | margin: 30px auto; | ||
| + | } | ||
| + | .modal-content { | ||
| + | -webkit-box-shadow: 0 5px 15px rgba(0, 0, 0, 0.5); | ||
| + | box-shadow: 0 5px 15px rgba(0, 0, 0, 0.5); | ||
| + | } | ||
| + | .modal-sm { | ||
| + | width: 300px; | ||
| + | } | ||
| + | } | ||
| + | @media (min-width: 992px) { | ||
| + | .modal-lg { | ||
| + | width: 900px; | ||
| + | } | ||
| + | } | ||
| + | .tooltip { | ||
| + | position: absolute; | ||
| + | z-index: 1070; | ||
| + | display: block; | ||
| + | font-family: "Helvetica Neue", Helvetica, Arial, sans-serif; | ||
| + | font-style: normal; | ||
| + | font-weight: 400; | ||
| + | line-height: 1.42857143; | ||
| + | line-break: auto; | ||
| + | text-align: left; | ||
| + | text-align: start; | ||
| + | text-decoration: none; | ||
| + | text-shadow: none; | ||
| + | text-transform: none; | ||
| + | letter-spacing: normal; | ||
| + | word-break: normal; | ||
| + | word-spacing: normal; | ||
| + | word-wrap: normal; | ||
| + | white-space: normal; | ||
| + | font-size: 12px; | ||
| + | filter: alpha(opacity=0); | ||
| + | opacity: 0; | ||
| + | } | ||
| + | .tooltip.in { | ||
| + | filter: alpha(opacity=90); | ||
| + | opacity: 0.9; | ||
| + | } | ||
| + | .tooltip.top { | ||
| + | padding: 5px 0; | ||
| + | margin-top: -3px; | ||
| + | } | ||
| + | .tooltip.right { | ||
| + | padding: 0 5px; | ||
| + | margin-left: 3px; | ||
| + | } | ||
| + | .tooltip.bottom { | ||
| + | padding: 5px 0; | ||
| + | margin-top: 3px; | ||
| + | } | ||
| + | .tooltip.left { | ||
| + | padding: 0 5px; | ||
| + | margin-left: -3px; | ||
| + | } | ||
| + | .tooltip.top .tooltip-arrow { | ||
| + | bottom: 0; | ||
| + | left: 50%; | ||
| + | margin-left: -5px; | ||
| + | border-width: 5px 5px 0; | ||
| + | border-top-color: #000; | ||
| + | } | ||
| + | .tooltip.top-left .tooltip-arrow { | ||
| + | right: 5px; | ||
| + | bottom: 0; | ||
| + | margin-bottom: -5px; | ||
| + | border-width: 5px 5px 0; | ||
| + | border-top-color: #000; | ||
| + | } | ||
| + | .tooltip.top-right .tooltip-arrow { | ||
| + | bottom: 0; | ||
| + | left: 5px; | ||
| + | margin-bottom: -5px; | ||
| + | border-width: 5px 5px 0; | ||
| + | border-top-color: #000; | ||
| + | } | ||
| + | .tooltip.right .tooltip-arrow { | ||
| + | top: 50%; | ||
| + | left: 0; | ||
| + | margin-top: -5px; | ||
| + | border-width: 5px 5px 5px 0; | ||
| + | border-right-color: #000; | ||
| + | } | ||
| + | .tooltip.left .tooltip-arrow { | ||
| + | top: 50%; | ||
| + | right: 0; | ||
| + | margin-top: -5px; | ||
| + | border-width: 5px 0 5px 5px; | ||
| + | border-left-color: #000; | ||
| + | } | ||
| + | .tooltip.bottom .tooltip-arrow { | ||
| + | top: 0; | ||
| + | left: 50%; | ||
| + | margin-left: -5px; | ||
| + | border-width: 0 5px 5px; | ||
| + | border-bottom-color: #000; | ||
| + | } | ||
| + | .tooltip.bottom-left .tooltip-arrow { | ||
| + | top: 0; | ||
| + | right: 5px; | ||
| + | margin-top: -5px; | ||
| + | border-width: 0 5px 5px; | ||
| + | border-bottom-color: #000; | ||
| + | } | ||
| + | .tooltip.bottom-right .tooltip-arrow { | ||
| + | top: 0; | ||
| + | left: 5px; | ||
| + | margin-top: -5px; | ||
| + | border-width: 0 5px 5px; | ||
| + | border-bottom-color: #000; | ||
| + | } | ||
| + | .tooltip-inner { | ||
| + | max-width: 200px; | ||
| + | padding: 3px 8px; | ||
| + | color: #fff; | ||
| + | text-align: center; | ||
| + | background-color: #000; | ||
| + | border-radius: 4px; | ||
| + | } | ||
| + | .tooltip-arrow { | ||
| + | position: absolute; | ||
| + | width: 0; | ||
| + | height: 0; | ||
| + | border-color: transparent; | ||
| + | border-style: solid; | ||
| + | } | ||
| + | .popover { | ||
| + | position: absolute; | ||
| + | top: 0; | ||
| + | left: 0; | ||
| + | z-index: 1060; | ||
| + | display: none; | ||
| + | max-width: 276px; | ||
| + | padding: 1px; | ||
| + | font-family: "Helvetica Neue", Helvetica, Arial, sans-serif; | ||
| + | font-style: normal; | ||
| + | font-weight: 400; | ||
| + | line-height: 1.42857143; | ||
| + | line-break: auto; | ||
| + | text-align: left; | ||
| + | text-align: start; | ||
| + | text-decoration: none; | ||
| + | text-shadow: none; | ||
| + | text-transform: none; | ||
| + | letter-spacing: normal; | ||
| + | word-break: normal; | ||
| + | word-spacing: normal; | ||
| + | word-wrap: normal; | ||
| + | white-space: normal; | ||
| + | font-size: 14px; | ||
| + | background-color: #fff; | ||
| + | background-clip: padding-box; | ||
| + | border: 1px solid #ccc; | ||
| + | border: 1px solid rgba(0, 0, 0, 0.2); | ||
| + | border-radius: 6px; | ||
| + | -webkit-box-shadow: 0 5px 10px rgba(0, 0, 0, 0.2); | ||
| + | box-shadow: 0 5px 10px rgba(0, 0, 0, 0.2); | ||
| + | } | ||
| + | .popover.top { | ||
| + | margin-top: -10px; | ||
| + | } | ||
| + | .popover.right { | ||
| + | margin-left: 10px; | ||
| + | } | ||
| + | .popover.bottom { | ||
| + | margin-top: 10px; | ||
| + | } | ||
| + | .popover.left { | ||
| + | margin-left: -10px; | ||
| + | } | ||
| + | .popover > .arrow { | ||
| + | border-width: 11px; | ||
| + | } | ||
| + | .popover > .arrow, | ||
| + | .popover > .arrow:after { | ||
| + | position: absolute; | ||
| + | display: block; | ||
| + | width: 0; | ||
| + | height: 0; | ||
| + | border-color: transparent; | ||
| + | border-style: solid; | ||
| + | } | ||
| + | .popover > .arrow:after { | ||
| + | content: ""; | ||
| + | border-width: 10px; | ||
| + | } | ||
| + | .popover.top > .arrow { | ||
| + | bottom: -11px; | ||
| + | left: 50%; | ||
| + | margin-left: -11px; | ||
| + | border-top-color: #999999; | ||
| + | border-top-color: rgba(0, 0, 0, 0.25); | ||
| + | border-bottom-width: 0; | ||
| + | } | ||
| + | .popover.top > .arrow:after { | ||
| + | bottom: 1px; | ||
| + | margin-left: -10px; | ||
| + | content: " "; | ||
| + | border-top-color: #fff; | ||
| + | border-bottom-width: 0; | ||
| + | } | ||
| + | .popover.right > .arrow { | ||
| + | top: 50%; | ||
| + | left: -11px; | ||
| + | margin-top: -11px; | ||
| + | border-right-color: #999999; | ||
| + | border-right-color: rgba(0, 0, 0, 0.25); | ||
| + | border-left-width: 0; | ||
| + | } | ||
| + | .popover.right > .arrow:after { | ||
| + | bottom: -10px; | ||
| + | left: 1px; | ||
| + | content: " "; | ||
| + | border-right-color: #fff; | ||
| + | border-left-width: 0; | ||
| + | } | ||
| + | .popover.bottom > .arrow { | ||
| + | top: -11px; | ||
| + | left: 50%; | ||
| + | margin-left: -11px; | ||
| + | border-top-width: 0; | ||
| + | border-bottom-color: #999999; | ||
| + | border-bottom-color: rgba(0, 0, 0, 0.25); | ||
| + | } | ||
| + | .popover.bottom > .arrow:after { | ||
| + | top: 1px; | ||
| + | margin-left: -10px; | ||
| + | content: " "; | ||
| + | border-top-width: 0; | ||
| + | border-bottom-color: #fff; | ||
| + | } | ||
| + | .popover.left > .arrow { | ||
| + | top: 50%; | ||
| + | right: -11px; | ||
| + | margin-top: -11px; | ||
| + | border-right-width: 0; | ||
| + | border-left-color: #999999; | ||
| + | border-left-color: rgba(0, 0, 0, 0.25); | ||
| + | } | ||
| + | .popover.left > .arrow:after { | ||
| + | right: 1px; | ||
| + | bottom: -10px; | ||
| + | content: " "; | ||
| + | border-right-width: 0; | ||
| + | border-left-color: #fff; | ||
| + | } | ||
| + | .popover-title { | ||
| + | padding: 8px 14px; | ||
| + | margin: 0; | ||
| + | font-size: 14px; | ||
| + | background-color: #f7f7f7; | ||
| + | border-bottom: 1px solid #ebebeb; | ||
| + | border-radius: 5px 5px 0 0; | ||
| + | } | ||
| + | .popover-content { | ||
| + | padding: 9px 14px; | ||
| + | } | ||
| + | .carousel { | ||
| + | position: relative; | ||
| + | } | ||
| + | .carousel-inner { | ||
| + | position: relative; | ||
| + | width: 100%; | ||
| + | overflow: hidden; | ||
| + | } | ||
| + | .carousel-inner > .item { | ||
| + | position: relative; | ||
| + | display: none; | ||
| + | -webkit-transition: 0.6s ease-in-out left; | ||
| + | -o-transition: 0.6s ease-in-out left; | ||
| + | transition: 0.6s ease-in-out left; | ||
| + | } | ||
| + | .carousel-inner > .item > img, | ||
| + | .carousel-inner > .item > a > img { | ||
| + | line-height: 1; | ||
| + | } | ||
| + | @media all and (transform-3d), (-webkit-transform-3d) { | ||
| + | .carousel-inner > .item { | ||
| + | -webkit-transition: -webkit-transform 0.6s ease-in-out; | ||
| + | -o-transition: -o-transform 0.6s ease-in-out; | ||
| + | transition: -webkit-transform 0.6s ease-in-out; | ||
| + | transition: transform 0.6s ease-in-out; | ||
| + | transition: transform 0.6s ease-in-out, -webkit-transform 0.6s ease-in-out, -o-transform 0.6s ease-in-out; | ||
| + | -webkit-backface-visibility: hidden; | ||
| + | backface-visibility: hidden; | ||
| + | -webkit-perspective: 1000px; | ||
| + | perspective: 1000px; | ||
| + | } | ||
| + | .carousel-inner > .item.next, | ||
| + | .carousel-inner > .item.active.right { | ||
| + | -webkit-transform: translate3d(100%, 0, 0); | ||
| + | transform: translate3d(100%, 0, 0); | ||
| + | left: 0; | ||
| + | } | ||
| + | .carousel-inner > .item.prev, | ||
| + | .carousel-inner > .item.active.left { | ||
| + | -webkit-transform: translate3d(-100%, 0, 0); | ||
| + | transform: translate3d(-100%, 0, 0); | ||
| + | left: 0; | ||
| + | } | ||
| + | .carousel-inner > .item.next.left, | ||
| + | .carousel-inner > .item.prev.right, | ||
| + | .carousel-inner > .item.active { | ||
| + | -webkit-transform: translate3d(0, 0, 0); | ||
| + | transform: translate3d(0, 0, 0); | ||
| + | left: 0; | ||
| + | } | ||
| + | } | ||
| + | .carousel-inner > .active, | ||
| + | .carousel-inner > .next, | ||
| + | .carousel-inner > .prev { | ||
| + | display: block; | ||
| + | } | ||
| + | .carousel-inner > .active { | ||
| + | left: 0; | ||
| + | } | ||
| + | .carousel-inner > .next, | ||
| + | .carousel-inner > .prev { | ||
| + | position: absolute; | ||
| + | top: 0; | ||
| + | width: 100%; | ||
| + | } | ||
| + | .carousel-inner > .next { | ||
| + | left: 100%; | ||
| + | } | ||
| + | .carousel-inner > .prev { | ||
| + | left: -100%; | ||
| + | } | ||
| + | .carousel-inner > .next.left, | ||
| + | .carousel-inner > .prev.right { | ||
| + | left: 0; | ||
| + | } | ||
| + | .carousel-inner > .active.left { | ||
| + | left: -100%; | ||
| + | } | ||
| + | .carousel-inner > .active.right { | ||
| + | left: 100%; | ||
| + | } | ||
| + | .carousel-control { | ||
| + | position: absolute; | ||
| + | top: 0; | ||
| + | bottom: 0; | ||
| + | left: 0; | ||
| + | width: 15%; | ||
| + | font-size: 20px; | ||
| + | color: #fff; | ||
| + | text-align: center; | ||
| + | text-shadow: 0 1px 2px rgba(0, 0, 0, 0.6); | ||
| + | background-color: rgba(0, 0, 0, 0); | ||
| + | filter: alpha(opacity=50); | ||
| + | opacity: 0.5; | ||
| + | } | ||
| + | .carousel-control.left { | ||
| + | background-image: -webkit-linear-gradient(left, rgba(0, 0, 0, 0.5) 0%, rgba(0, 0, 0, 0.0001) 100%); | ||
| + | background-image: -o-linear-gradient(left, rgba(0, 0, 0, 0.5) 0%, rgba(0, 0, 0, 0.0001) 100%); | ||
| + | background-image: -webkit-gradient(linear, left top, right top, from(rgba(0, 0, 0, 0.5)), to(rgba(0, 0, 0, 0.0001))); | ||
| + | background-image: linear-gradient(to right, rgba(0, 0, 0, 0.5) 0%, rgba(0, 0, 0, 0.0001) 100%); | ||
| + | filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#80000000', endColorstr='#00000000', GradientType=1); | ||
| + | background-repeat: repeat-x; | ||
| + | } | ||
| + | .carousel-control.right { | ||
| + | right: 0; | ||
| + | left: auto; | ||
| + | background-image: -webkit-linear-gradient(left, rgba(0, 0, 0, 0.0001) 0%, rgba(0, 0, 0, 0.5) 100%); | ||
| + | background-image: -o-linear-gradient(left, rgba(0, 0, 0, 0.0001) 0%, rgba(0, 0, 0, 0.5) 100%); | ||
| + | background-image: -webkit-gradient(linear, left top, right top, from(rgba(0, 0, 0, 0.0001)), to(rgba(0, 0, 0, 0.5))); | ||
| + | background-image: linear-gradient(to right, rgba(0, 0, 0, 0.0001) 0%, rgba(0, 0, 0, 0.5) 100%); | ||
| + | filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#00000000', endColorstr='#80000000', GradientType=1); | ||
| + | background-repeat: repeat-x; | ||
| + | } | ||
| + | .carousel-control:hover, | ||
| + | .carousel-control:focus { | ||
| + | color: #fff; | ||
| + | text-decoration: none; | ||
| + | outline: 0; | ||
| + | filter: alpha(opacity=90); | ||
| + | opacity: 0.9; | ||
| + | } | ||
| + | .carousel-control .icon-prev, | ||
| + | .carousel-control .icon-next, | ||
| + | .carousel-control .glyphicon-chevron-left, | ||
| + | .carousel-control .glyphicon-chevron-right { | ||
| + | position: absolute; | ||
| + | top: 50%; | ||
| + | z-index: 5; | ||
| + | display: inline-block; | ||
| + | margin-top: -10px; | ||
| + | } | ||
| + | .carousel-control .icon-prev, | ||
| + | .carousel-control .glyphicon-chevron-left { | ||
| + | left: 50%; | ||
| + | margin-left: -10px; | ||
| + | } | ||
| + | .carousel-control .icon-next, | ||
| + | .carousel-control .glyphicon-chevron-right { | ||
| + | right: 50%; | ||
| + | margin-right: -10px; | ||
| + | } | ||
| + | .carousel-control .icon-prev, | ||
| + | .carousel-control .icon-next { | ||
| + | width: 20px; | ||
| + | height: 20px; | ||
| + | font-family: serif; | ||
| + | line-height: 1; | ||
| + | } | ||
| + | .carousel-control .icon-prev:before { | ||
| + | content: "\2039"; | ||
| + | } | ||
| + | .carousel-control .icon-next:before { | ||
| + | content: "\203a"; | ||
| + | } | ||
| + | .carousel-indicators { | ||
| + | position: absolute; | ||
| + | bottom: 10px; | ||
| + | left: 50%; | ||
| + | z-index: 15; | ||
| + | width: 60%; | ||
| + | padding-left: 0; | ||
| + | margin-left: -30%; | ||
| + | text-align: center; | ||
| + | list-style: none; | ||
| + | } | ||
| + | .carousel-indicators li { | ||
| + | display: inline-block; | ||
| + | width: 10px; | ||
| + | height: 10px; | ||
| + | margin: 1px; | ||
| + | text-indent: -999px; | ||
| + | cursor: pointer; | ||
| + | background-color: #000 \9; | ||
| + | background-color: rgba(0, 0, 0, 0); | ||
| + | border: 1px solid #fff; | ||
| + | border-radius: 10px; | ||
| + | } | ||
| + | .carousel-indicators .active { | ||
| + | width: 12px; | ||
| + | height: 12px; | ||
| + | margin: 0; | ||
| + | background-color: #fff; | ||
| + | } | ||
| + | .carousel-caption { | ||
| + | position: absolute; | ||
| + | right: 15%; | ||
| + | bottom: 20px; | ||
| + | left: 15%; | ||
| + | z-index: 10; | ||
| + | padding-top: 20px; | ||
| + | padding-bottom: 20px; | ||
| + | color: #fff; | ||
| + | text-align: center; | ||
| + | text-shadow: 0 1px 2px rgba(0, 0, 0, 0.6); | ||
| + | } | ||
| + | .carousel-caption .btn { | ||
| + | text-shadow: none; | ||
| + | } | ||
| + | @media screen and (min-width: 768px) { | ||
| + | .carousel-control .glyphicon-chevron-left, | ||
| + | .carousel-control .glyphicon-chevron-right, | ||
| + | .carousel-control .icon-prev, | ||
| + | .carousel-control .icon-next { | ||
| + | width: 30px; | ||
| + | height: 30px; | ||
| + | margin-top: -10px; | ||
| + | font-size: 30px; | ||
| + | } | ||
| + | .carousel-control .glyphicon-chevron-left, | ||
| + | .carousel-control .icon-prev { | ||
| + | margin-left: -10px; | ||
| + | } | ||
| + | .carousel-control .glyphicon-chevron-right, | ||
| + | .carousel-control .icon-next { | ||
| + | margin-right: -10px; | ||
| + | } | ||
| + | .carousel-caption { | ||
| + | right: 20%; | ||
| + | left: 20%; | ||
| + | padding-bottom: 30px; | ||
| + | } | ||
| + | .carousel-indicators { | ||
| + | bottom: 20px; | ||
| + | } | ||
| + | } | ||
| + | .clearfix:before, | ||
| + | .clearfix:after, | ||
| + | .dl-horizontal dd:before, | ||
| + | .dl-horizontal dd:after, | ||
| + | .container:before, | ||
| + | .container:after, | ||
| + | .container-fluid:before, | ||
| + | .container-fluid:after, | ||
| + | .row:before, | ||
| + | .row:after, | ||
| + | .form-horizontal .form-group:before, | ||
| + | .form-horizontal .form-group:after, | ||
| + | .btn-toolbar:before, | ||
| + | .btn-toolbar:after, | ||
| + | .btn-group-vertical > .btn-group:before, | ||
| + | .btn-group-vertical > .btn-group:after, | ||
| + | .nav:before, | ||
| + | .nav:after, | ||
| + | .navbar:before, | ||
| + | .navbar:after, | ||
| + | .navbar-header:before, | ||
| + | .navbar-header:after, | ||
| + | .navbar-collapse:before, | ||
| + | .navbar-collapse:after, | ||
| + | .pager:before, | ||
| + | .pager:after, | ||
| + | .panel-body:before, | ||
| + | .panel-body:after, | ||
| + | .modal-header:before, | ||
| + | .modal-header:after, | ||
| + | .modal-footer:before, | ||
| + | .modal-footer:after { | ||
| + | display: table; | ||
| + | content: " "; | ||
| + | } | ||
| + | .clearfix:after, | ||
| + | .dl-horizontal dd:after, | ||
| + | .container:after, | ||
| + | .container-fluid:after, | ||
| + | .row:after, | ||
| + | .form-horizontal .form-group:after, | ||
| + | .btn-toolbar:after, | ||
| + | .btn-group-vertical > .btn-group:after, | ||
| + | .nav:after, | ||
| + | .navbar:after, | ||
| + | .navbar-header:after, | ||
| + | .navbar-collapse:after, | ||
| + | .pager:after, | ||
| + | .panel-body:after, | ||
| + | .modal-header:after, | ||
| + | .modal-footer:after { | ||
| + | clear: both; | ||
| + | } | ||
| + | .center-block { | ||
| + | display: block; | ||
| + | margin-right: auto; | ||
| + | margin-left: auto; | ||
| + | } | ||
| + | .pull-right { | ||
| + | float: right !important; | ||
| + | } | ||
| + | .pull-left { | ||
| + | float: left !important; | ||
| + | } | ||
| + | .hide { | ||
| + | display: none !important; | ||
| + | } | ||
| + | .show { | ||
| + | display: block !important; | ||
| + | } | ||
| + | .invisible { | ||
| + | visibility: hidden; | ||
| + | } | ||
| + | .text-hide { | ||
| + | font: 0/0 a; | ||
| + | color: transparent; | ||
| + | text-shadow: none; | ||
| + | background-color: transparent; | ||
| + | border: 0; | ||
| + | } | ||
| + | .hidden { | ||
| + | display: none !important; | ||
| + | } | ||
| + | .affix { | ||
| + | position: fixed; | ||
| + | } | ||
| + | @-ms-viewport { | ||
| + | width: device-width; | ||
| + | } | ||
| + | .visible-xs, | ||
| + | .visible-sm, | ||
| + | .visible-md, | ||
| + | .visible-lg { | ||
| + | display: none !important; | ||
| + | } | ||
| + | .visible-xs-block, | ||
| + | .visible-xs-inline, | ||
| + | .visible-xs-inline-block, | ||
| + | .visible-sm-block, | ||
| + | .visible-sm-inline, | ||
| + | .visible-sm-inline-block, | ||
| + | .visible-md-block, | ||
| + | .visible-md-inline, | ||
| + | .visible-md-inline-block, | ||
| + | .visible-lg-block, | ||
| + | .visible-lg-inline, | ||
| + | .visible-lg-inline-block { | ||
| + | display: none !important; | ||
| + | } | ||
| + | @media (max-width: 767px) { | ||
| + | .visible-xs { | ||
| + | display: block !important; | ||
| + | } | ||
| + | table.visible-xs { | ||
| + | display: table !important; | ||
| + | } | ||
| + | tr.visible-xs { | ||
| + | display: table-row !important; | ||
| + | } | ||
| + | th.visible-xs, | ||
| + | td.visible-xs { | ||
| + | display: table-cell !important; | ||
| + | } | ||
| + | } | ||
| + | @media (max-width: 767px) { | ||
| + | .visible-xs-block { | ||
| + | display: block !important; | ||
| + | } | ||
| + | } | ||
| + | @media (max-width: 767px) { | ||
| + | .visible-xs-inline { | ||
| + | display: inline !important; | ||
| + | } | ||
| + | } | ||
| + | @media (max-width: 767px) { | ||
| + | .visible-xs-inline-block { | ||
| + | display: inline-block !important; | ||
| + | } | ||
| + | } | ||
| + | @media (min-width: 768px) and (max-width: 991px) { | ||
| + | .visible-sm { | ||
| + | display: block !important; | ||
| + | } | ||
| + | table.visible-sm { | ||
| + | display: table !important; | ||
| + | } | ||
| + | tr.visible-sm { | ||
| + | display: table-row !important; | ||
| + | } | ||
| + | th.visible-sm, | ||
| + | td.visible-sm { | ||
| + | display: table-cell !important; | ||
| + | } | ||
| + | } | ||
| + | @media (min-width: 768px) and (max-width: 991px) { | ||
| + | .visible-sm-block { | ||
| + | display: block !important; | ||
| + | } | ||
| + | } | ||
| + | @media (min-width: 768px) and (max-width: 991px) { | ||
| + | .visible-sm-inline { | ||
| + | display: inline !important; | ||
| + | } | ||
| + | } | ||
| + | @media (min-width: 768px) and (max-width: 991px) { | ||
| + | .visible-sm-inline-block { | ||
| + | display: inline-block !important; | ||
| + | } | ||
| + | } | ||
| + | @media (min-width: 992px) and (max-width: 1199px) { | ||
| + | .visible-md { | ||
| + | display: block !important; | ||
| + | } | ||
| + | table.visible-md { | ||
| + | display: table !important; | ||
| + | } | ||
| + | tr.visible-md { | ||
| + | display: table-row !important; | ||
| + | } | ||
| + | th.visible-md, | ||
| + | td.visible-md { | ||
| + | display: table-cell !important; | ||
| + | } | ||
| + | } | ||
| + | @media (min-width: 992px) and (max-width: 1199px) { | ||
| + | .visible-md-block { | ||
| + | display: block !important; | ||
| + | } | ||
| + | } | ||
| + | @media (min-width: 992px) and (max-width: 1199px) { | ||
| + | .visible-md-inline { | ||
| + | display: inline !important; | ||
| + | } | ||
| + | } | ||
| + | @media (min-width: 992px) and (max-width: 1199px) { | ||
| + | .visible-md-inline-block { | ||
| + | display: inline-block !important; | ||
| + | } | ||
| + | } | ||
| + | @media (min-width: 1200px) { | ||
| + | .visible-lg { | ||
| + | display: block !important; | ||
| + | } | ||
| + | table.visible-lg { | ||
| + | display: table !important; | ||
| + | } | ||
| + | tr.visible-lg { | ||
| + | display: table-row !important; | ||
| + | } | ||
| + | th.visible-lg, | ||
| + | td.visible-lg { | ||
| + | display: table-cell !important; | ||
| + | } | ||
| + | } | ||
| + | @media (min-width: 1200px) { | ||
| + | .visible-lg-block { | ||
| + | display: block !important; | ||
| + | } | ||
| + | } | ||
| + | @media (min-width: 1200px) { | ||
| + | .visible-lg-inline { | ||
| + | display: inline !important; | ||
| + | } | ||
| + | } | ||
| + | @media (min-width: 1200px) { | ||
| + | .visible-lg-inline-block { | ||
| + | display: inline-block !important; | ||
| + | } | ||
| + | } | ||
| + | @media (max-width: 767px) { | ||
| + | .hidden-xs { | ||
| + | display: none !important; | ||
| + | } | ||
| + | } | ||
| + | @media (min-width: 768px) and (max-width: 991px) { | ||
| + | .hidden-sm { | ||
| + | display: none !important; | ||
| + | } | ||
| + | } | ||
| + | @media (min-width: 992px) and (max-width: 1199px) { | ||
| + | .hidden-md { | ||
| + | display: none !important; | ||
| + | } | ||
| + | } | ||
| + | @media (min-width: 1200px) { | ||
| + | .hidden-lg { | ||
| + | display: none !important; | ||
| + | } | ||
| + | } | ||
| + | .visible-print { | ||
| + | display: none !important; | ||
| + | } | ||
| + | @media print { | ||
| + | .visible-print { | ||
| + | display: block !important; | ||
| + | } | ||
| + | table.visible-print { | ||
| + | display: table !important; | ||
| + | } | ||
| + | tr.visible-print { | ||
| + | display: table-row !important; | ||
| + | } | ||
| + | th.visible-print, | ||
| + | td.visible-print { | ||
| + | display: table-cell !important; | ||
| + | } | ||
| + | } | ||
| + | .visible-print-block { | ||
| + | display: none !important; | ||
| + | } | ||
| + | @media print { | ||
| + | .visible-print-block { | ||
| + | display: block !important; | ||
| + | } | ||
| + | } | ||
| + | .visible-print-inline { | ||
| + | display: none !important; | ||
| + | } | ||
| + | @media print { | ||
| + | .visible-print-inline { | ||
| + | display: inline !important; | ||
| + | } | ||
| + | } | ||
| + | .visible-print-inline-block { | ||
| + | display: none !important; | ||
| + | } | ||
| + | @media print { | ||
| + | .visible-print-inline-block { | ||
| + | display: inline-block !important; | ||
| + | } | ||
| + | } | ||
| + | @media print { | ||
| + | .hidden-print { | ||
| + | display: none !important; | ||
| + | } | ||
| + | } | ||
| + | </style> | ||
| + | <!-- Bootstrap stop--> | ||
| + | <title>Experiments</title> | ||
| + | <style> | ||
| + | body, | ||
| + | html { | ||
| + | margin: 0; | ||
| + | padding: 0; | ||
| + | scroll-behavior: smooth; | ||
| + | } | ||
| − | + | body { | |
| + | background: linear-gradient(to right, #e9fffd, #fff, #e9fffd); | ||
| + | } | ||
| + | #content{ | ||
| + | width: 100vw; | ||
| + | padding: 0; | ||
| + | margin: 0; | ||
| + | } | ||
| + | #top_title{ | ||
| + | display: none; | ||
| + | } | ||
| + | #bodyDiv { | ||
| + | background: linear-gradient(#111116, #0b0c24); | ||
| + | } | ||
| − | + | a { | |
| − | + | text-decoration: none; | |
| + | } | ||
| − | + | /* Scrollbar customized */ | |
| − | + | ||
| − | + | ||
| − | + | ::-webkit-scrollbar { | |
| + | width: 12px; | ||
| + | } | ||
| + | ::-webkit-scrollbar-track { | ||
| + | box-shadow: inset 0 0 5px #00695c; | ||
| + | background: #ddd; | ||
| + | } | ||
| + | ::-webkit-scrollbar-thumb { | ||
| + | background: linear-gradient(to bottom, #007722, #00aa55); | ||
| + | border-radius: 3px; | ||
| + | box-shadow: 2px 2px 4px grey; | ||
| + | } | ||
| − | + | ::-webkit-scrollbar-thumb:hover { | |
| − | + | background: linear-gradient(to bottom, #7d1b54, #e6369c); | |
| − | + | border: 2px solid #75194f; | |
| − | + | } | |
| − | + | ||
| − | + | ||
| − | + | ||
| − | + | a { | |
| + | text-decoration: none; | ||
| + | } | ||
| − | + | /* Scrollbar customized */ | |
| − | + | ||
| − | + | ||
| − | + | ||
| − | + | ||
| − | + | ||
| − | + | ||
| − | + | ||
| − | + | ||
| − | + | ||
| + | ::-webkit-scrollbar { | ||
| + | width: 12px; | ||
| + | } | ||
| + | ::-webkit-scrollbar-track { | ||
| + | box-shadow: inset 0 0 5px #00695c; | ||
| + | background: #ddd; | ||
| + | } | ||
| + | ::-webkit-scrollbar-thumb { | ||
| + | background: linear-gradient(to bottom, #007722, #00aa55); | ||
| + | border-radius: 3px; | ||
| + | box-shadow: 2px 2px 4px grey; | ||
| + | } | ||
| + | ::-webkit-scrollbar-thumb:hover { | ||
| + | background: linear-gradient(to bottom, #7d1b54, #e6369c); | ||
| + | border: 2px solid #75194f; | ||
| + | } | ||
| + | |||
| + | /* Navbar */ | ||
| + | |||
| + | nav img { | ||
| + | height: 48px; | ||
| + | width: auto; | ||
| + | border-radius: 3px; | ||
| + | } | ||
| + | |||
| + | .navbar { | ||
| + | border-radius: 0; | ||
| + | margin: 0; | ||
| + | position: sticky; | ||
| + | background: #fff; | ||
| + | border-bottom: 1px solid #444; | ||
| + | } | ||
| + | |||
| + | .navbar-brand { | ||
| + | padding: 10px 20px 50px 20px; | ||
| + | } | ||
| + | |||
| + | .navbar-nav > li > a { | ||
| + | padding: 25px; | ||
| + | text-decoration: none; | ||
| + | color: #00b129; | ||
| + | border-radius: 3px; | ||
| + | font-size: 16px; | ||
| + | transition: 0.2s; | ||
| + | } | ||
| + | |||
| + | .navbar-nav > li > a:hover { | ||
| + | background: #00a126; | ||
| + | color: #fff; | ||
| + | } | ||
| + | |||
| + | .navbar-toggle img { | ||
| + | height: 25px; | ||
| + | } | ||
| + | |||
| + | .navbar-right { | ||
| + | margin-right: 2vw; | ||
| + | } | ||
| + | |||
| + | .glyphicon { | ||
| + | margin-right: 1vw; | ||
| + | } | ||
| + | |||
| + | .dropdown-menu li { | ||
| + | min-width: 20vw; | ||
| + | } | ||
| + | |||
| + | .dropdown-menu > li > a { | ||
| + | font-size: 16px; | ||
| + | padding: 2vh 2vw; | ||
| + | color: #777; | ||
| + | } | ||
| + | |||
| + | @media (max-width: 765px) { | ||
| + | .navbar { | ||
| + | background: #fff; | ||
| + | } | ||
| + | |||
| + | .navbar-nav { | ||
| + | background: #fff; | ||
| + | } | ||
| + | |||
| + | .dropdown-menu li { | ||
| + | min-width: 60vw; | ||
| + | } | ||
| + | |||
| + | .dropdown-menu > li > a { | ||
| + | padding: 3vh 8vw; | ||
| + | } | ||
| + | } | ||
| + | |||
| + | /* Safety */ | ||
| + | |||
| + | .safety { | ||
| + | display: flex; | ||
| + | flex-direction: column; | ||
| + | min-height: 100vh; | ||
| + | margin-bottom: 10vh; | ||
| + | } | ||
| + | |||
| + | .safety h1 { | ||
| + | margin-top: 22vh; | ||
| + | margin-bottom: 5vh; | ||
| + | text-align: center; | ||
| + | color: #00969b; | ||
| + | font-size: 36px; | ||
| + | text-transform: uppercase; | ||
| + | } | ||
| + | |||
| + | .safetyRow { | ||
| + | display: flex; | ||
| + | width: 80%; | ||
| + | margin: auto; | ||
| + | } | ||
| + | |||
| + | .safetyCard { | ||
| + | display: flex; | ||
| + | flex-direction: column; | ||
| + | min-height: 10vh; | ||
| + | padding: 4vh 0; | ||
| + | padding-top: 8vh; | ||
| + | margin: 5vh 2vw; | ||
| + | border-radius: 15px; | ||
| + | background: linear-gradient(to right, #003d3d, #006858); | ||
| + | flex: 1; | ||
| + | box-shadow: 2px 3px 5px #aaa; | ||
| + | } | ||
| + | |||
| + | .safetyCard h1 { | ||
| + | font-size: 28px; | ||
| + | margin-bottom: 5vh; | ||
| + | margin-top: 1vh; | ||
| + | text-transform: capitalize; | ||
| + | color: #3affff; | ||
| + | } | ||
| + | |||
| + | .safetyCard h2 { | ||
| + | color: #ffffff; | ||
| + | font-size: 23px; | ||
| + | width: 80%; | ||
| + | margin: auto; | ||
| + | text-align: center; | ||
| + | } | ||
| + | |||
| + | .safetyCard ul { | ||
| + | margin: 1vh auto; | ||
| + | padding-inline-start: 10px; | ||
| + | } | ||
| + | |||
| + | .safetyCard li { | ||
| + | font-size: 15px; | ||
| + | color: #3affff; | ||
| + | width: 80%; | ||
| + | text-align: justify; | ||
| + | margin: 3vh auto; | ||
| + | } | ||
| + | |||
| + | .safetyCard button { | ||
| + | background: none; | ||
| + | color: #fff; | ||
| + | border: 2px solid #fff; | ||
| + | border-radius: 5px; | ||
| + | font-size: 15px; | ||
| + | margin: auto; | ||
| + | width: 120px; | ||
| + | height: 40px; | ||
| + | margin-bottom: 5vh; | ||
| + | margin-top: 5vh; | ||
| + | transition: 0.3s; | ||
| + | outline: none; | ||
| + | } | ||
| + | |||
| + | .safetyCard button:hover { | ||
| + | background: #fff; | ||
| + | color: #003d3d; | ||
| + | } | ||
| + | |||
| + | .safetyCard span { | ||
| + | color: #e7ffff; | ||
| + | font-size: 18px; | ||
| + | } | ||
| + | |||
| + | #proto { | ||
| + | flex: none; | ||
| + | margin: 5vh auto; | ||
| + | width: 36vw; | ||
| + | } | ||
| + | |||
| + | @media (max-width: 760px) { | ||
| + | .safetyRow { | ||
| + | flex-direction: column; | ||
| + | } | ||
| + | |||
| + | #proto { | ||
| + | width: 74vw; | ||
| + | } | ||
| + | } | ||
| + | |||
| + | /* Modal */ | ||
| + | |||
| + | .modal { | ||
| + | display: none; | ||
| + | position: fixed; | ||
| + | z-index: 1; | ||
| + | padding-top: 100px; | ||
| + | width: 100%; | ||
| + | height: 100%; | ||
| + | overflow: auto; | ||
| + | background-color: rgba(0, 0, 0, 0.4); | ||
| + | } | ||
| + | |||
| + | .modal-content { | ||
| + | position: relative; | ||
| + | background-color: #fefefe; | ||
| + | margin: auto; | ||
| + | padding: 0; | ||
| + | border: 1px solid #888; | ||
| + | padding-bottom: 3vh; | ||
| + | width: 60%; | ||
| + | box-shadow: 0 4px 8px 0 rgba(0, 0, 0, 0.2), | ||
| + | 0 6px 20px 0 rgba(0, 0, 0, 0.2); | ||
| + | animation-name: animatetop; | ||
| + | animation-duration: 0.4s; | ||
| + | display: flex; | ||
| + | margin-bottom: 5vh; | ||
| + | flex-direction: column; | ||
| + | } | ||
| + | |||
| + | .modal-content h2 { | ||
| + | text-align: center; | ||
| + | color: #444; | ||
| + | width: 80%; | ||
| + | margin: auto; | ||
| + | margin-top: 2vh; | ||
| + | font-size: 25px; | ||
| + | } | ||
| + | |||
| + | .modal-content p { | ||
| + | color: #666; | ||
| + | width: 80%; | ||
| + | margin: 4vh auto; | ||
| + | } | ||
| + | |||
| + | @keyframes animatetop { | ||
| + | from { | ||
| + | top: -300px; | ||
| + | opacity: 0; | ||
| + | } | ||
| + | to { | ||
| + | top: 0; | ||
| + | opacity: 1; | ||
| + | } | ||
| + | } | ||
| + | |||
| + | .close { | ||
| + | color: #cc0000; | ||
| + | transition: 0.2s; | ||
| + | font-size: 30px; | ||
| + | width: 20px; | ||
| + | height: auto; | ||
| + | margin-left: 96%; | ||
| + | margin-top: 12px; | ||
| + | } | ||
| + | |||
| + | .close:hover, | ||
| + | .close:focus { | ||
| + | text-decoration: none; | ||
| + | cursor: pointer; | ||
| + | color: #cc0000; | ||
| + | } | ||
| + | |||
| + | @media (max-width: 760px) { | ||
| + | .modal-content { | ||
| + | width: 80%; | ||
| + | } | ||
| + | |||
| + | .modal-content h2 { | ||
| + | font-size: 20px; | ||
| + | } | ||
| + | |||
| + | .close { | ||
| + | margin-left: 94%; | ||
| + | } | ||
| + | } | ||
| + | |||
| + | @media (max-width: 600px) { | ||
| + | .close { | ||
| + | margin-left: 90%; | ||
| + | } | ||
| + | } | ||
| + | |||
| + | /* Footer */ | ||
| + | |||
| + | .footer { | ||
| + | height: 10vh; | ||
| + | background-color: #ddd; | ||
| + | color: #444; | ||
| + | text-align: center; | ||
| + | display: flex; | ||
| + | } | ||
| + | |||
| + | .footer p { | ||
| + | font-size: 12px; | ||
| + | margin: auto; | ||
| + | } | ||
| + | </style> | ||
| + | </head> | ||
| + | <body> | ||
| + | <nav class="navbar navbar-fixed-top" style="position: fixed;" id="myNav"> | ||
| + | <div class="container-fluid"> | ||
| + | <div class="navbar-header"> | ||
| + | <button | ||
| + | type="button" | ||
| + | class="navbar-toggle" | ||
| + | data-toggle="collapse" | ||
| + | data-target="#myNavbar" | ||
| + | > | ||
| + | <img | ||
| + | src="https://2019.igem.org/wiki/images/1/1b/T--Bioriidl_Somaiya--ham.png" | ||
| + | alt="" | ||
| + | style="margin-top: 3px;" | ||
| + | /> | ||
| + | </button> | ||
| + | <a | ||
| + | class="navbar-brand" | ||
| + | href="https://2019.igem.org/Team:Bioriidl_Somaiya" | ||
| + | > | ||
| + | <img | ||
| + | src="https://2019.igem.org/wiki/images/d/de/T--Bioriidl_Somaiya--igem.png" | ||
| + | alt="igem logo" | ||
| + | /> | ||
| + | </a> | ||
| + | </div> | ||
| + | <div | ||
| + | class="collapse navbar-collapse" | ||
| + | style="max-height: 100vh;" | ||
| + | id="myNavbar" | ||
| + | > | ||
| + | <ul class="nav navbar-nav"> | ||
| + | <li class="dropdown"> | ||
| + | <a class="dropdown-toggle" data-toggle="dropdown" href="#" | ||
| + | >Team <span class="caret"></span | ||
| + | ></a> | ||
| + | <ul class="dropdown-menu"> | ||
| + | <li | ||
| + | onclick="window.location= 'https://2019.igem.org/Team:Bioriidl_Somaiya/Team'; " | ||
| + | > | ||
| + | <a href="#">Team Members</a> | ||
| + | </li> | ||
| + | <li | ||
| + | onclick="window.location= 'https://2019.igem.org/Team:Bioriidl_Somaiya/Collaborations'; " | ||
| + | > | ||
| + | <a href="#">Collaboration</a> | ||
| + | </li> | ||
| + | </ul> | ||
| + | </li> | ||
| + | <li class="dropdown"> | ||
| + | <a class="dropdown-toggle" data-toggle="dropdown" href="#" | ||
| + | >Project <span class="caret"></span | ||
| + | ></a> | ||
| + | <ul class="dropdown-menu"> | ||
| + | <li | ||
| + | onclick="window.location= 'https://2019.igem.org/Team:Bioriidl_Somaiya/Description'; " | ||
| + | > | ||
| + | <a href="#">Description</a> | ||
| + | </li> | ||
| + | <li | ||
| + | onclick="window.location= 'https://2019.igem.org/Team:Bioriidl_Somaiya/Design'; " | ||
| + | > | ||
| + | <a href="#">Design</a> | ||
| + | </li> | ||
| + | <li | ||
| + | onclick="window.location= 'https://2019.igem.org/Team:Bioriidl_Somaiya/Experiments'; " | ||
| + | > | ||
| + | <a href="#">Experiments</a> | ||
| + | </li> | ||
| + | <li | ||
| + | onclick="window.location= 'https://2019.igem.org/Team:Bioriidl_Somaiya/Experiments'; " | ||
| + | > | ||
| + | <a href="#">Notebook</a> | ||
| + | </li> | ||
| + | <li | ||
| + | onclick="window.location= 'https://2019.igem.org/Team:Bioriidl_Somaiya/Team'; " | ||
| + | > | ||
| + | <a href="#">Contributions</a> | ||
| + | </li> | ||
| + | <li | ||
| + | onclick="window.location= 'https://2019.igem.org/Team:Bioriidl_Somaiya/Results'; " | ||
| + | > | ||
| + | <a href="#">Results</a> | ||
| + | </li> | ||
| + | <li | ||
| + | onclick="window.location= 'https://2019.igem.org/Team:Bioriidl_Somaiya/Demonstrate'; " | ||
| + | > | ||
| + | <a href="#">Demonstration</a> | ||
| + | </li> | ||
| + | <li | ||
| + | onclick="window.location= 'https://2019.igem.org/Team:Bioriidl_Somaiya/Improve'; " | ||
| + | > | ||
| + | <a href="#">Improvements</a> | ||
| + | </li> | ||
| + | <!-- <li onclick="window.location= 'https://2019.igem.org/Team:Bioriidl_Somaiya/Attributions'; "> | ||
| + | <a href="#">Attributions</a> | ||
| + | </li> --> | ||
| + | </ul> | ||
| + | </li> | ||
| + | <li class="dropdown"> | ||
| + | <a class="dropdown-toggle" data-toggle="dropdown" href="#" | ||
| + | >Parts <span class="caret"></span | ||
| + | ></a> | ||
| + | <ul class="dropdown-menu"> | ||
| + | <li | ||
| + | onclick="window.location= 'https://2019.igem.org/Team:Bioriidl_Somaiya/Parts'; " | ||
| + | > | ||
| + | <a href="#">Parts Overview</a> | ||
| + | </li> | ||
| + | <li | ||
| + | onclick="window.location= 'https://2019.igem.org/Team:Bioriidl_Somaiya/Parts'; " | ||
| + | > | ||
| + | <a href="#">Basic Parts</a> | ||
| + | </li> | ||
| + | <li | ||
| + | onclick="window.location= 'https://2019.igem.org/Team:Bioriidl_Somaiya/Parts'; " | ||
| + | > | ||
| + | <a href="#">Composite Parts</a> | ||
| + | </li> | ||
| + | <li | ||
| + | onclick="window.location= 'https://2019.igem.org/Team:Bioriidl_Somaiya/Parts'; " | ||
| + | > | ||
| + | <a href="#">Parts Collection</a> | ||
| + | </li> | ||
| + | </ul> | ||
| + | </li> | ||
| + | <li | ||
| + | onclick="window.location= 'https://2019.igem.org/Team:Bioriidl_Somaiya/Safety'; " | ||
| + | > | ||
| + | <a href="#">Safety</a> | ||
| + | </li> | ||
| + | <li class="dropdown"> | ||
| + | <a class="dropdown-toggle" data-toggle="dropdown" href="#" | ||
| + | >Human Practices <span class="caret"></span | ||
| + | ></a> | ||
| + | <ul class="dropdown-menu"> | ||
| + | <li | ||
| + | onclick="window.location= 'https://2019.igem.org/Team:Bioriidl_Somaiya/Human_Practices'; " | ||
| + | > | ||
| + | <a href="#">Human Practices</a> | ||
| + | </li> | ||
| + | <li | ||
| + | onclick="window.location= 'https://2019.igem.org/Team:Bioriidl_Somaiya/Public_Engagement'; " | ||
| + | > | ||
| + | <a href="#">Education and Engagement</a> | ||
| + | </li> | ||
| + | </ul> | ||
| + | </li> | ||
| + | <li class="dropdown"> | ||
| + | <a class="dropdown-toggle" data-toggle="dropdown" href="#" | ||
| + | >Awards <span class="caret"></span | ||
| + | ></a> | ||
| + | <ul class="dropdown-menu"> | ||
| + | <li | ||
| + | onclick="window.location= 'https://2019.igem.org/Team:Bioriidl_Somaiya/Entrepreneurship'; " | ||
| + | > | ||
| + | <a href="#">Entrepreneurship</a> | ||
| + | </li> | ||
| + | <li | ||
| + | onclick="window.location= 'https://2019.igem.org/Team:Bioriidl_Somaiya/Hardware'; " | ||
| + | > | ||
| + | <a href="#">Hardware</a> | ||
| + | </li> | ||
| + | <!-- <li onclick="window.location= ''; "> | ||
| + | <a href="#">Measurement</a> | ||
| + | </li> | ||
| + | <li onclick="window.location= ''; "><a href="#">Model</a></li> | ||
| + | <li onclick="window.location= ''; "><a href="#">Plant</a></li> --> | ||
| + | <li | ||
| + | onclick="window.location= 'https://2019.igem.org/Team:Bioriidl_Somaiya/Software'; " | ||
| + | > | ||
| + | <a href="#">Software</a> | ||
| + | </li> | ||
| + | </ul> | ||
| + | </li> | ||
| + | <li | ||
| + | onclick="window.location= 'https://igem.org/2019_Judging_Form?team=Bioriidl_Somaiya'; " | ||
| + | > | ||
| + | <a href="#">Judging Form</a> | ||
| + | </li> | ||
| + | </ul> | ||
| + | </div> | ||
| + | </div> | ||
| + | </nav> | ||
| + | |||
| + | <div class="safety"> | ||
| + | <h1>Experiments</h1> | ||
| + | <div class="safetyRow"> | ||
| + | <div class="safetyCard"> | ||
| + | <h1>Experiment No. 1</h1> | ||
| + | <h2>Testing the efficiency of nichrome wire</h2> | ||
| + | <ul> | ||
| + | <li> | ||
| + | <span>Aim:</span> To check whether the current passed through | ||
| + | nichrome wire increase the temperature. | ||
| + | </li> | ||
| + | <li> | ||
| + | <span>Result:</span> The average time required for a 10 °C rise | ||
| + | was determined to be 4.2 seconds. Thus, 0.56sec for a 1 °C rise in | ||
| + | temperature. | ||
| + | </li> | ||
| + | </ul> | ||
| + | <button class="myBtn" onclick="openModal(0)">Learn More</button> | ||
| + | </div> | ||
| + | |||
| + | <div class="safetyCard"> | ||
| + | <h1>Experiment No. 2</h1> | ||
| + | <h2>Using nichrome wire</h2> | ||
| + | <ul> | ||
| + | <li> | ||
| + | <span>Aim:</span> To determine the time required for the water to | ||
| + | raise the temperature by 1 °C using nichrome loop. | ||
| + | </li> | ||
| + | <li> | ||
| + | <span>Result:</span> Thus, it takes 1mins 12sec to raise the | ||
| + | temperature from 25 °C to 100 °C, so 0.96sec is taken to rise 1 °C | ||
| + | in temperature for water. | ||
| + | </li> | ||
| + | </ul> | ||
| + | <button class="myBtn" onclick="openModal(1)">Learn More</button> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="safetyRow"> | ||
| + | <div class="safetyCard"> | ||
| + | <h1>Experiment No. 3</h1> | ||
| + | <h2>Sterilize NA media by direct heating using nichrome wire</h2> | ||
| + | <ul> | ||
| + | <li> | ||
| + | <span>Aim:</span> To determine the time required for the media to | ||
| + | raise the temperature by 1 °C. | ||
| + | </li> | ||
| + | <li> | ||
| + | <span>Result:</span> Thus it takes 45 seconds to raise the | ||
| + | temperature of the medium from 25 °C to 100 °C. | ||
| + | </li> | ||
| + | </ul> | ||
| + | <button class="myBtn" onclick="openModal(2)">Learn More</button> | ||
| + | </div> | ||
| + | |||
| + | <div class="safetyCard"> | ||
| + | <h1>Experiment No. 4</h1> | ||
| + | <h2> | ||
| + | Sterilize media by indirect heating using oil along with nichrome | ||
| + | wire (wrapped around the flask containing oil) | ||
| + | </h2> | ||
| + | <ul> | ||
| + | <li> | ||
| + | <span>Aim:</span> To determine the time required to raise the | ||
| + | temperature of the media from 25 °C to 100°C using a nichrome wire | ||
| + | tied around a flask containing oil which has the medium immersed | ||
| + | into it. | ||
| + | </li> | ||
| + | <li><span>Result:</span> This method is not as efficient.</li> | ||
| + | </ul> | ||
| + | <button class="myBtn" onclick="openModal(3)">Learn More</button> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="safetyRow"> | ||
| + | <div class="safetyCard"> | ||
| + | <h1>Experiment No. 5</h1> | ||
| + | <h2> | ||
| + | Sterilize media by indirect heating using oil with nichrome wire | ||
| + | wrapped around the tube and dipped in oil. | ||
| + | </h2> | ||
| + | <ul> | ||
| + | <li> | ||
| + | <span>Aim:</span> To determine the time required to raise the | ||
| + | temperature of water from 25 °C to 100 °C using nichrome wire | ||
| + | directly wrapped around tube and dipped in flask containing oil | ||
| + | for heat preservation. | ||
| + | </li> | ||
| + | <li><span>Result:</span> This method was ruled out.</li> | ||
| + | </ul> | ||
| + | <button class="myBtn" onclick="openModal(4)">Learn More</button> | ||
| + | </div> | ||
| + | |||
| + | <div class="safetyCard"> | ||
| + | <h1>Experiment No. 6</h1> | ||
| + | <h2>Sterilize media by indirect sterilization using powder ink</h2> | ||
| + | <ul> | ||
| + | <li> | ||
| + | <span>Aim:</span> To determine the time required to raise the | ||
| + | temperature of water from 25 °C to 100 °C by using ink powder | ||
| + | particles (magnetic) by holding over induction coils. | ||
| + | </li> | ||
| + | <li><span>Result:</span> Method ruled out.</li> | ||
| + | </ul> | ||
| + | <button class="myBtn" onclick="openModal(5)">Learn More</button> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="safetyRow"> | ||
| + | <div class="safetyCard"> | ||
| + | <h1>Experiment No. 7</h1> | ||
| + | <h2>Viscosity checking of medium that can be used</h2> | ||
| + | <ul> | ||
| + | <li> | ||
| + | <span>Aim:</span> To check the time required for water, and | ||
| + | various media to flow through Ostwald's viscometer. | ||
| + | </li> | ||
| + | <li> | ||
| + | <span>Result:</span> Liquid media passed easily through the tiny | ||
| + | capillary whereas heated agar was very difficult to pass. Hence | ||
| + | tubing dimensions could be decided for further manufacture. | ||
| + | </li> | ||
| + | </ul> | ||
| + | <button class="myBtn" onclick="openModal(6)">Learn More</button> | ||
| + | </div> | ||
| + | |||
| + | <div class="safetyCard"> | ||
| + | <h1>Experiment No. 8</h1> | ||
| + | <h2>Developing UV Chamber</h2> | ||
| + | <ul> | ||
| + | <li> | ||
| + | <span>Aim:</span> Circuit assembly inside an acrylic chamber with | ||
| + | holding space for petri dishes in the centre. UV- C tubes | ||
| + | installed inside the chamber on top and bottom to evenly irradiate | ||
| + | the plates. | ||
| + | </li> | ||
| + | </ul> | ||
| + | <button class="myBtn" onclick="openModal(7)">Learn More</button> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="safetyRow"> | ||
| + | <div class="safetyCard"> | ||
| + | <h1>Experiment No. 9</h1> | ||
| + | <h2>Sterilize using UV-C germicidal tube</h2> | ||
| + | <ul> | ||
| + | <li> | ||
| + | <span>Aim:</span> To determine effectivity of the manufactured UVC | ||
| + | chamber by exposing plates with plain unsterilized medium to UV | ||
| + | radiation for varied amounts of time and incubation of plates and | ||
| + | enumeration. | ||
| + | </li> | ||
| + | <li> | ||
| + | <span>Result:</span> 8 minutes of exposure to UV was enough for | ||
| + | killing microbial population in media. | ||
| + | </li> | ||
| + | </ul> | ||
| + | <button class="myBtn" onclick="openModal(8)">Learn More</button> | ||
| + | </div> | ||
| + | |||
| + | <div class="safetyCard"> | ||
| + | <h1>Experiment No. 10</h1> | ||
| + | <h2>Media preparation</h2> | ||
| + | <ul> | ||
| + | <li> | ||
| + | <span>Aim:</span> Preparation of 250 ml Sabourauds agar and 24 | ||
| + | petri plates and set it for autoclaving. | ||
| + | </li> | ||
| + | </ul> | ||
| + | <button class="myBtn" onclick="openModal(9)">Learn More</button> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="safetyRow"> | ||
| + | <div class="safetyCard"> | ||
| + | <h1>Experiment No. 11</h1> | ||
| + | <h2>Endophyte experiment</h2> | ||
| + | <ul> | ||
| + | <li> | ||
| + | <span>Aim:</span> Isolation of endophytes from Neem (Azadirachta | ||
| + | indica) and Tulsi (Ocimum tenuiflorum). | ||
| + | </li> | ||
| + | <li> | ||
| + | <span>Result:</span> Presence of Endophytes have been observed and | ||
| + | they have been screened for further use. | ||
| + | </li> | ||
| + | </ul> | ||
| + | <button class="myBtn" onclick="openModal(10)">Learn More</button> | ||
| + | </div> | ||
| + | |||
| + | <div class="safetyCard"> | ||
| + | <h1>Experiment No. 12</h1> | ||
| + | <h2>Subculturing of endophytes to obtain a pure-culture</h2> | ||
| + | <button class="myBtn" onclick="openModal(11)">Learn More</button> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="safetyRow"> | ||
| + | <div class="safetyCard"> | ||
| + | <h1>Experiment No. 13</h1> | ||
| + | <h2>Replating of colonies</h2> | ||
| + | <ul> | ||
| + | <li><span>Aim:</span> Replating and segregation of colonies.</li> | ||
| + | </ul> | ||
| + | <button class="myBtn" onclick="openModal(12)">Learn More</button> | ||
| + | </div> | ||
| + | |||
| + | <div class="safetyCard"> | ||
| + | <h1>Experiment No. 14</h1> | ||
| + | <h2>Isolation of grown colonies</h2> | ||
| + | <ul> | ||
| + | <li> | ||
| + | <span>Aim:</span> Isolation of various different colonies found on | ||
| + | sabourauds plates which had plant parts. | ||
| + | </li> | ||
| + | <li> | ||
| + | <span>Result:</span> There were pure culture growth of colonies | ||
| + | with no other colony presence. | ||
| + | </li> | ||
| + | </ul> | ||
| + | <button class="myBtn" onclick="openModal(13)">Learn More</button> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="safetyRow"> | ||
| + | <div class="safetyCard"> | ||
| + | <h1>Experiment No. 15</h1> | ||
| + | <h2>Checking growth</h2> | ||
| + | <ul> | ||
| + | <li> | ||
| + | <span>Observations:</span> Most plates showed pure culture | ||
| + | characteristics. These colonies were chosen. | ||
| + | </li> | ||
| + | </ul> | ||
| + | <button class="myBtn" onclick="openModal(14)">Learn More</button> | ||
| + | </div> | ||
| + | |||
| + | <div class="safetyCard"> | ||
| + | <h1>Experiment No. 16</h1> | ||
| + | <h2>Mass culture</h2> | ||
| + | <ul> | ||
| + | <li> | ||
| + | <span>Aim:</span> Making large amounts of the chosen culture. | ||
| + | </li> | ||
| + | </ul> | ||
| + | <button class="myBtn" onclick="openModal(15)">Learn More</button> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="safetyRow"> | ||
| + | <div class="safetyCard"> | ||
| + | <h1>Experiment No. 17</h1> | ||
| + | <h2>CAD modeling of U.V. chamber using AutoCAD Software</h2> | ||
| + | <button class="myBtn" onclick="openModal(16)">Learn More</button> | ||
| + | </div> | ||
| + | |||
| + | <div class="safetyCard"> | ||
| + | <h1>Experiment No. 18</h1> | ||
| + | <h2>New UV - C chamber manufacture</h2> | ||
| + | <button class="myBtn" onclick="openModal(17)">Learn More</button> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="safetyRow"> | ||
| + | <div class="safetyCard"> | ||
| + | <h1>Experiment No. 19</h1> | ||
| + | <h2>Testing UVC chamber using plates</h2> | ||
| + | <ul> | ||
| + | <li> | ||
| + | <span>Aim:</span> To test microbicidal effect of the new UVC | ||
| + | assembly by using plates. Preparation of NB and using 9 plates to | ||
| + | test for U.V. (for 2,4,6,8,10mins closed plate, 5mins closed, | ||
| + | 5mins open). | ||
| + | </li> | ||
| + | <li> | ||
| + | <span>Result:</span> 5 minutes were enough to sterilize the media | ||
| + | under this new chamber. | ||
| + | </li> | ||
| + | </ul> | ||
| + | <button class="myBtn" onclick="openModal(18)">Learn More</button> | ||
| + | </div> | ||
| + | |||
| + | <div class="safetyCard"> | ||
| + | <h1>Experiment No. 20</h1> | ||
| + | <h2>Spiral Tube experiments</h2> | ||
| + | <button class="myBtn" onclick="openModal(19)">Learn More</button> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="safetyRow"> | ||
| + | <div class="safetyCard"> | ||
| + | <h1>Experiment No. 21</h1> | ||
| + | <h2>Exploration of desired genes</h2> | ||
| + | <ul> | ||
| + | <li> | ||
| + | <span>Aim:</span> To select a protein/compound secreted by | ||
| + | organism that has killing/ inhibitory activity on contaminating | ||
| + | organisms. | ||
| + | </li> | ||
| + | </ul> | ||
| + | <button class="myBtn" onclick="openModal(20)">Learn More</button> | ||
| + | </div> | ||
| + | |||
| + | <div class="safetyCard"> | ||
| + | <h1>Experiment No. 22</h1> | ||
| + | <h2>Model testing using various media</h2> | ||
| + | <ul> | ||
| + | <li> | ||
| + | <span>Aim:</span> To see the effect of UV on organisms growing on | ||
| + | different media. | ||
| + | </li> | ||
| + | <li> | ||
| + | <span>Result:</span> MacConkey media and LB media showed minimum | ||
| + | growth of organisms and Mueller Hinton agar showed very scanty | ||
| + | growth of contaminants.Maximum growth was found in Nutrient agar. | ||
| + | </li> | ||
| + | </ul> | ||
| + | <button class="myBtn" onclick="openModal(21)">Learn More</button> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="safetyRow"> | ||
| + | <div class="safetyCard" id="proto"> | ||
| + | <h1>Experiment No. 23</h1> | ||
| + | <h2>Prototype building</h2> | ||
| + | <ul> | ||
| + | <li> | ||
| + | <span>Aim:</span> To build a prototype of our experiment using CAD | ||
| + | model. | ||
| + | </li> | ||
| + | </ul> | ||
| + | <button class="myBtn" onclick="openModal(22)">Learn More</button> | ||
| + | </div> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="footer"> | ||
| + | <p>Bioriidl © Copyright 2019. All rights reserved.</p> | ||
| + | </div> | ||
| + | |||
| + | <div class="modal"> | ||
| + | <div class="modal-content"> | ||
| + | <span class="close">×</span> | ||
| + | <h2>Testing the efficiency of nichrome wire</h2> | ||
| + | <p> | ||
| + | <br>Date: 6th April 2019 | ||
| + | <br />Time: 2:00 PM - 4:00 PM <br />Total number of attendees: 8 | ||
| + | <br />Number of male attendees: 5 <br />Number of female attendees: 3 | ||
| + | <br />Shreya, Prerak, Chintan, Sourabh, Ashtad, Mihir and Apeksha | ||
| + | |||
| + | <br /><br />Aim - To check whether the current passed through nichrome | ||
| + | wire increase the temperature. <br /><br />Protocol - <br />Step 1: - | ||
| + | Nichrome wire is twisted around the mercury bulb of the thermometer. | ||
| + | <br />Step 2: - Two sprung metal clips were attached on either end of | ||
| + | nichrome wire and DC power supply giving 3.2A and 32 Volt was passed. | ||
| + | <br />Step 4: - Repeat the above steps for 3-4 times for average | ||
| + | result <br /><br />Result - The average time required for a 10 °C rise | ||
| + | was determined to be 4.2 seconds. Thus, 0.56sec for a 1 °C rise in | ||
| + | temperature. | ||
| + | </p> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="modal"> | ||
| + | <div class="modal-content"> | ||
| + | <span class="close">×</span> | ||
| + | <h2>Using nichrome wire</h2> | ||
| + | <p> | ||
| + | <br>Date: 12th April 2019 | ||
| + | <br>Time: 2:00 PM - 6:00 PM | ||
| + | <br>Total number of attendees: 5 | ||
| + | <br>Number of male attendees: 2 | ||
| + | <br>Number of female attendees: 3 | ||
| + | <br>Ashtad, Shreya, Mihir, and Apeksha | ||
| + | |||
| + | <br><br>Aim - To determine the time required for the water to raise the temperature by 1 °C using nichrome loop. | ||
| + | <br><br>Protocol - | ||
| + | <br>Step 1: - Firstly a nichrome wire is twisted around a test tube with the help of captain tap (As this tap can sustain high and current). | ||
| + | <br>Step 2: - 5ml of water is taken into the test tube. | ||
| + | <br>Step 3: - Two sprung metal clips were attached on the ends of nichrome wire and DC power supply giving 3.2A and 32 Volt was passed. | ||
| + | <br>Step 4: - Repeat the above steps for 3-4 times for the average result. | ||
| + | <br><br>Observation - The temperature of water rises from 25 °C to 100 °C in an average time of 2mins 46secs. | ||
| + | <br><br>The result - Thus, it takes 1mins 12sec to raise the temperature from 25 °C to 100 °C, so 0.96sec is taken to rise 1 °C in temperature for water.</p> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="modal"> | ||
| + | <div class="modal-content"> | ||
| + | <span class="close">×</span> | ||
| + | <h2>Sterilize NA media by direct heating using nichrome wire</h2> | ||
| + | <p> | ||
| + | <br>Date: 15th - 17th April 2019 | ||
| + | <br>Time: 2:00 PM - 6:00 PM | ||
| + | <br>Total number of attendees: 4 | ||
| + | <br>Number of male attendees: 2 | ||
| + | <br>Number of female attendees: 2 | ||
| + | <br>Ashtad, Shreya, Mihir, and Apeksha | ||
| + | |||
| + | <br><br>Aim - To determine the time required for the media to raise the temperature by 1 °C. | ||
| + | <br><br>Protocol - | ||
| + | <br>Step 1: - Firstly a nichrome wire is twisted around a test tube with the help of captain tape (As this tape can sustain high heat and current). | ||
| + | <br>Step 2: - 5ml of this is taken into the test tube. | ||
| + | <br>Step 3: - Two sprung metal clips were attached on the ends of nichrome wire and DC power supply giving 3.2A and 32 Volt was passed. | ||
| + | <br>Step 4: - Using a thermometer for measuring, increase in temperature of the medium was noted and tabulated. | ||
| + | <br><br>Observation- The temperature of the water in the tube raises to 100 °C in 45 seconds. | ||
| + | <br><br>Result- Thus it takes 45 seconds to raise the temperature of the medium from 25 °C to 100 °C. | ||
| + | </p> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="modal"> | ||
| + | <div class="modal-content"> | ||
| + | <span class="close">×</span> | ||
| + | <h2>Sterilize media by indirect heating using oil along with nichrome wire (wrapped around the flask containing oil)</h2> | ||
| + | <p> | ||
| + | <br>Date: 22nd - 23rd April 2019 | ||
| + | <br>Time: 2:00 PM - 6:00 PM | ||
| + | <br>Total number of attendees: 4 | ||
| + | <br>Number of male attendees: 2 | ||
| + | <br>Number of female attendees: 2 | ||
| + | <br>Ashtad, Shreya, Mihir, and Apeksha | ||
| + | <br><br>Aim - To determine the time required to raise the temperature of the media from 25 °C to 100°C using a nichrome wire tied around a flask containing oil which has the medium immersed into it. | ||
| + | <br><br>Protocol - | ||
| + | <br>Step 1 - First the nichrome wire is wrapped around the flask which is filled with oil. | ||
| + | <br>Step 2 - 5ml water is taken in a tube and immersed in the oil | ||
| + | <br>Step 3 - Two sprung metal clips were attached on the ends of nichrome wire and DC power supply giving 3.2A and 32 Volt was passed. | ||
| + | <br>Step 4 - Using a thermometer for measuring, increase in temperature of the medium was noted and tabulated. | ||
| + | <br>Step 5 - The reading were compared with that of only nichrome wire | ||
| + | <br><br>Observation- The temperature of the water raised from 25 °C to 100 °C in 2 mins 20 seconds. | ||
| + | <br><br>Result- This method is not as efficient. | ||
| + | |||
| + | </p> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="modal"> | ||
| + | <div class="modal-content"> | ||
| + | <span class="close">×</span> | ||
| + | <h2>Sterilize media by indirect heating using oil with nichrome wire wrapped around the tube and dipped in oil</h2> | ||
| + | <p> | ||
| + | <br>Date- 23rd April 2019 | ||
| + | <br>Time- 2:00 pm- 6:00 pm | ||
| + | <br> Ashtad, Shreya, Mihir and Apeksha | ||
| + | <br><br> Aim - To determine the time required to raise the temperature of water from 25 °C to 100 °C using nichrome wire directly wrapped around tube and dipped in flask containing oil for heat preservation. | ||
| + | <br> <br> Protocol - | ||
| + | <br> Step 1 - The nichrome wire is wrapped around the tube containing 5 ml water and dipped in flask filled with oil. | ||
| + | <br> Step 2 - Two sprung metal clips were attached on the ends of nichrome wire and DC power supply giving 3.2A and 32 Volt was passed. | ||
| + | <br> Step 3 - Using a thermometer for measuring, increase in temperature of the medium was noted and tabulated. | ||
| + | <br> Step 5 - The reading were compared with that of only nichrome wire | ||
| + | <br><br> Observation- The temperature of the water raised from 25 °C to 100 °C in 2 minutes but along with oil spluttering. | ||
| + | <br><br> Result- This method was ruled out. | ||
| + | </p> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="modal"> | ||
| + | <div class="modal-content"> | ||
| + | <span class="close">×</span> | ||
| + | <h2>Sterilize media by indirect sterilization using powder ink</h2> | ||
| + | <p> | ||
| + | <br> Date: 15th May 2019 | ||
| + | <br> Time: 12:00 PM - 5:00 PM | ||
| + | <br> Total number of attendees: 4 | ||
| + | <br> Number of male attendees: 2 | ||
| + | <br> Number of female attendees: 2 | ||
| + | <br> Ashtad, Shreya, Mihir, and Apeksha | ||
| + | <br><br> Aim- To determine the time required to raise the temperature of water from 25 °C to 100 °C by using ink powder particles (magnetic) by holding over induction coils. | ||
| + | <br><br> Protocol- | ||
| + | <br> Step 1 - Use 1gm of ink powder and mix it with 5 ml of water. | ||
| + | <br> Step 2 - Hold the tube over induction coils for heating. | ||
| + | <br> Step 3 - Using a thermometer inside the tube, increase in temperature is timed and tabulated. | ||
| + | <br><br> Observation- There was no effective rise in temperature | ||
| + | <br><br> Result - Method ruled out.</p> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="modal"> | ||
| + | <div class="modal-content"> | ||
| + | <span class="close">×</span> | ||
| + | <h2>Viscosity checking of medium that can be used</h2> | ||
| + | <p> | ||
| + | <br>Date- 14-15 th June | ||
| + | <br>Apeksha, Shreya | ||
| + | <br><br>Aim- to check the time required for water, and various media to flow through Ostwalds viscometer | ||
| + | <br><br>Protocol- | ||
| + | <br>Step 1 - prepare 100 ml of water, nutrient broth, nutrient agar and lb broth | ||
| + | <br>Step 2 - pass 10 ml of water through the viscometer and note time | ||
| + | <br>Step 3 - pass 10 ml of nutrient broth and note time | ||
| + | <br>Step 4 - pass 10 ml luria bertani broth through viscometer and note time | ||
| + | <br>Step 5 - pass 10 ml nutrient agar through viscometer and note time | ||
| + | <br><br>Observations- | ||
| + | Water passed through in 1 min 12 seconds | ||
| + | Nutrient broth passed through in 1 min 34 seconds | ||
| + | Luria Bertani broth passed through in 1 min 32 seconds | ||
| + | Nutrient agar passed through viscometer kept in a heated water bath ( 60-70°C in 1 hours 20 minutes | ||
| + | <br><br>Result - Liquid media passed easily through the tiny capillary whereas heated agar was very difficult to pass. Hence tubing dimensions could be decided for further manufacture. | ||
| + | </p> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="modal"> | ||
| + | <div class="modal-content"> | ||
| + | <span class="close">×</span> | ||
| + | <h2>Developing UV Chamber</h2> | ||
| + | <p><br>Date: 17th - 23rd May 2019 | ||
| + | <br>Time: 12:00 PM - 5:00 PM | ||
| + | <br>Total number of attendees: 4 | ||
| + | <br>Number of male attendees: 3 | ||
| + | <br>Number of female attendees: 1 | ||
| + | <br> Ashtad, Sourabh, Mihir | ||
| + | |||
| + | <br><br> Aim- Circuit assembly inside an acrylic chamber with holding space for petri dishes in the centre. UV- C tubes installed inside the chamber on top and bottom to evenly irradiate the plates</p> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="modal"> | ||
| + | <div class="modal-content"> | ||
| + | <span class="close">×</span> | ||
| + | <h2>Sterilize using UV-C germicidal tube</h2> | ||
| + | <p> | ||
| + | <br>Date: 6th- 11th June 2019 | ||
| + | <br>Time: 1:00 PM - 4:00 PM | ||
| + | <br>Prerak, Chintan, Mihir, and Apeksha, Shreya | ||
| + | <br><br>Aim- To determine effectivity of the manufactured UVC chamber by exposing plates with plain unsterilized medium to UV radiation for varied amounts of time and incubation of plates and enumeration. | ||
| + | <br><br>Protocol- | ||
| + | <br>Step 1 - Prepare nutrient media | ||
| + | <br>Step 2 - After digestion, pour 20 ml of media onto plates and set to solidify. | ||
| + | <br>Step 3 - Expose plates to UV by placing them into the chamber (while switched off!) and switching the chamber on after closing the chamber lids. The time of exposure was varied (2, 4, 5[Lid and no lid], 6, 8, 10). | ||
| + | <br>Step 4 - Incubate plates at 37 °C for 24 hours. | ||
| + | <br>Step 5 - Observe and look for contaminants. | ||
| + | <br><br>Observation- There was a decrease in number of colonies as the time of exposure increased. | ||
| + | <br><br>Results - 8 minutes of exposure to UV was enough for killing microbial population in media. | ||
| + | |||
| + | </p> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="modal"> | ||
| + | <div class="modal-content"> | ||
| + | <span class="close">×</span> | ||
| + | <h2>Media preparation</h2> | ||
| + | <p> | ||
| + | <br>Date- 1st July | ||
| + | <br>Time - 9:00 am - 12:00 pm | ||
| + | <br>Shreya, Apeksha | ||
| + | |||
| + | |||
| + | <br><br>Aim- Preparation of 250 ml Sabourauds agar and 24 petri plates and set it for autoclaving | ||
| + | </p> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="modal"> | ||
| + | <div class="modal-content"> | ||
| + | <span class="close">×</span> | ||
| + | <h2>Endophyte experiment</h2> | ||
| + | <p> | ||
| + | <br>Date: 3rd July | ||
| + | <br>Time: 9:00 am - 6:00 pm | ||
| + | <br>Bhavna, Apeksha, Shreya, Chintan, Prerak | ||
| + | |||
| + | <br><br>Aim - Isolation of endophytes from Neem (Azadirachta indica) and Tulsi (Ocimum tenuiflorum) | ||
| + | <br><br>Protocol - | ||
| + | <br>Step 1 - Prepare yeast media ( Sabouraud's agar). | ||
| + | <br>Step 2 - alcohol sterilize the plant parts. Wash the plants, alcohol wash aseptically and wash with sterile water. | ||
| + | <br>Step 3 - Cut the parts between burners ( cut small parts) | ||
| + | <br>Step 4 - Using sterile spatula, transfer this to the agar plate. | ||
| + | <br>Step 5 - Let the sap ooze out and incubate at 37 °C for 24- 48 hours. | ||
| + | <br>Step 6 - After growth is observed, subculture the various colonies in sab broth. Centrifuge extract. Take supernatant and check antimicrobial activity against other organisms. | ||
| + | <br>Step 7 - Co Culturing - bacteria and fungi. Measure again, using Buchner flask. Incubate for intervals of two hours and check OD. If OD decreases, it shows positive result, i.e. inhibition. | ||
| + | <br><br>Observation- There was growth of colonies around the plant parts | ||
| + | <br><br>Result- Presence of Endophytes have been observed and they have been screened for further use. | ||
| + | </p> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="modal"> | ||
| + | <div class="modal-content"> | ||
| + | <span class="close">×</span> | ||
| + | <h2>Subculturing of endophytes to obtain a pure-culture</h2> | ||
| + | <p>Apeksha- Subculturing of endophytes to obtain a pure-culture (✖5) with the assistance of Miss. Bhavna</p> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="modal"> | ||
| + | <div class="modal-content"> | ||
| + | <span class="close">×</span> | ||
| + | <h2>Replating of colonies</h2> | ||
| + | <p> | ||
| + | <br>Date - 9th July 2019 | ||
| + | <br>Time- 12:00 pm - 3:00 pm | ||
| + | <br>Apeksha, Shreya | ||
| + | |||
| + | <br><br>Aim - Replating and segregation of colonies | ||
| + | <br><br>Protocol - | ||
| + | <br>Step 1 - Check if the plates show optimum growth | ||
| + | <br> Step 2 - Select colonies to further use in the process | ||
| + | <br>Step 3 - pick these colonies and transfer them to fresh plates | ||
| + | <br> Step 4 - Incubate plates at Room temperature for 48 hours. | ||
| + | </p> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="modal"> | ||
| + | <div class="modal-content"> | ||
| + | <span class="close">×</span> | ||
| + | <h2>Isolation of grown colonies</h2> | ||
| + | <p> | ||
| + | <br>Date - 8th July 2019 | ||
| + | <br>Time - 12:00 pm - 4:00 pm | ||
| + | <br>Apeksha, Shreya | ||
| + | |||
| + | <br><br>Aim - Isolation of various different colonies found on sabourauds plates which had plant parts. | ||
| + | The colonies are differentiated and subcultured on sabourauds agar plates to obtain pure cuture. | ||
| + | <br><br>Protocol- | ||
| + | <br>Step 1 - Screen all part plates | ||
| + | <br>Step 2 - Select and approve particular colonies with the desirable quality | ||
| + | <br>Step 3 - pick these colonies | ||
| + | <br>Step 4 - Take 20 ml of sterile sabourauds agar | ||
| + | <br>Step 5 - Inoculate selected colonies into the agar and incubate at room temperature for 48 hours | ||
| + | <br>Step 6 - Subculture the colonies into sabourauds agar slants and incubate at room temperature for 1 week. | ||
| + | <br><br>Result - There were pure culture growth of colonies with no other colony presence. | ||
| + | </p> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="modal"> | ||
| + | <div class="modal-content"> | ||
| + | <span class="close">×</span> | ||
| + | <h2>Checking growth</h2> | ||
| + | <p> | ||
| + | <br>Date - 10 th July 2019 | ||
| + | <br>Time - 9:00 am | ||
| + | <br>Shreya, Apeksha | ||
| + | |||
| + | <br><br>Aim- Select colonies for mass growth. | ||
| + | <br><br>Observation- Most plates showed pure culture characteristics. These colonies were chosen | ||
| + | </p> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="modal"> | ||
| + | <div class="modal-content"> | ||
| + | <span class="close">×</span> | ||
| + | <h2>Mass culture</h2> | ||
| + | <p> | ||
| + | <br>Date - 11th July to 18th July 2019 | ||
| + | <br>Shreya, Apeksha | ||
| + | <br><br>Aim - Making large amounts of the chosen culture | ||
| + | <br><br>Protocol- | ||
| + | <br>Step 1 - Prepare sterile sabourauds broth 20 ml per tube (x 15) | ||
| + | <br>Step 2 - Select desired colonies and inoculate into each tube | ||
| + | <br>Step 3 - set on shaker at room temperature for 1 week | ||
| + | <br>Step 4 - Check growth | ||
| + | </p> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="modal"> | ||
| + | <div class="modal-content"> | ||
| + | <span class="close">×</span> | ||
| + | <h2>CAD modeling of U.V. chamber using AutoCAD Software</h2> | ||
| + | <p> | ||
| + | <br>Date - 5th JULY | ||
| + | <br>Ashtad- CAD modeling of U.V. chamber using AutoCAD Software | ||
| + | <br>Sourabh + Mihir- U.V. Chamber assembled using laser cut black acrylic, circuits, hot-gun, and insulating tap | ||
| + | <br>Apeksha + Prerak- SDG post on Instagram (#4) | ||
| + | <br>Chintan- Studied the plants' sample requirements from the thesis- “Killer Activity of Yeast isolated from medicinal plants” | ||
| + | </p> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="modal"> | ||
| + | <div class="modal-content"> | ||
| + | <span class="close">×</span> | ||
| + | <h2>New UV - C chamber manufacture</h2> | ||
| + | <p> | ||
| + | <br>Date - 5 th July 2019 | ||
| + | <br>Mihir, Ashtad, Sourabh | ||
| + | <br><br>Aim- Making a new furnished UVC Chamber | ||
| + | <br><br>Protocol- | ||
| + | <br>Step 1 - making acrylic sheets assembly by laser cutting | ||
| + | <br>Step 2 - Refering to the CAD model made, the box is assembled | ||
| + | <br>Step 3 - circuit connections | ||
| + | |||
| + | </p> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="modal"> | ||
| + | <div class="modal-content"> | ||
| + | <span class="close">×</span> | ||
| + | <h2>Testing UVC chamber using plates</h2> | ||
| + | <p> | ||
| + | <br>Date - 20th July - 21st July | ||
| + | <br>Shreya, Apeksha, Chintan | ||
| + | <br><br>Aim - to test microbicidal effect of the new UVC assembly by using plates | ||
| + | <br><br>Protocol - | ||
| + | <br>Step 1 - Make nutrient agar | ||
| + | <br> Step 2 - After digestion, nutrient agar is poured into the plates | ||
| + | <br>Step 3 - the plates are exposed to the new chamber for 2, 4, 5, 6 ,8, 10 mins. | ||
| + | <br>Step 4 - Incubation at room temperature for 24 hours | ||
| + | <br><br>Observation - 5 minute plates showed maximum decrease in number | ||
| + | <br><br> Result - 5 minutes were enough to sterilize the media under this new chamber | ||
| + | </p> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="modal"> | ||
| + | <div class="modal-content"> | ||
| + | <span class="close">×</span> | ||
| + | <h2>Spiral Tube experiments</h2> | ||
| + | <p> | ||
| + | <br>Date - 7th JULY | ||
| + | <br>Chintan + Mihir + Apeksha = Spiral Tube experiments | ||
| + | <br>Apeksha + Shreya + Chintan = Bio-team meet-up over con-call | ||
| + | |||
| + | </p> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="modal"> | ||
| + | <div class="modal-content"> | ||
| + | <span class="close">×</span> | ||
| + | <h2>Exploration of desired genes</h2> | ||
| + | <p> | ||
| + | <br>Date - August | ||
| + | <br>Shreya, Chintan, Apeksha | ||
| + | <br><br>Aim - to select a protein/compound secreted by organism that has killing/ inhibitory activity on contaminating organisms. | ||
| + | |||
| + | <br><br> Notes- | ||
| + | <br>Tyrosinase | ||
| + | <br>Tyrosinase is an oxidase that is the rate -limiting enzyme for controlling the production of melanin. The enzyme is mainly involved in two distinct reactions of melanin synthesis; firstly, the hydroxylation of a monophenol and secondly, the conversion of an o-diphenol to the corresponding o-quinone. o-Quinone undergoes several reactions to eventually form melanin. Tyrosinase is a copper -containing enzyme present in plant and animal tissues that catalyzes the production of melanin and other pigments from tyrosine by oxidation, as in the blackening of a peeled or sliced potato exposed to air. It is found inside melanosomes which are synthesised in the skin melanocytes. In humans, the tyrosinase enzyme is encoded by the TYR gene. | ||
| + | <br>Clinical significance- | ||
| + | <br> A mutation in the tyrosinase gene resulting in impaired tyrosinase production leads to type I oculocutaneous albinism, a hereditary disorder that affects one in every 20,000 people. | ||
| + | Tyrosinase activity is very important. If uncontrolled during the synthesis of melanin, it results in increased melanin synthesis. Decreasing tyrosinase activity has been targeted for the betterment or prevention of conditions related to hyperpigmentation of the skin, such as melasma and age spots. | ||
| + | Several polyphenols, including flavonoids or stilbenoid, substrate analogues, free radical scavengers, and copper chelators, have been known to inhibit tyrosinase. Henceforth, the medical and cosmetic industries are focusing research on tyrosinase inhibitors to treat skin disorders. | ||
| + | |||
| + | |||
| + | |||
| + | |||
| + | <br>Reverse Translate results | ||
| + | <br>Results for 625 residue sequence "BAC87843.1 tyrosinase precursor 1 [Illex argentinus]" starting "MESYRLLVLV" | ||
| + | |||
| + | <br> >reverse translation of BAC87843.1 tyrosinase precursor 1 [Illex argentinus] to a 1875 base sequence of most likely codons. | ||
| + | |||
| + | <br><br>atggaaagctatcgcctgctggtgctggtgagcgcgtttggcctgtgccaggcgatggtg | ||
| + | gatgtgagccagagcgatggcctgcagagctgcctggatcgctttgcggatgataccagc | ||
| + | acctttagccagcaggaacagctgagcctgtgcagcaaatattatatgcagaaaaactgg | ||
| + | aaaagcgcggatgtgagcaaaccgaaaattagcaccctggcgaccatgagcccgcaggaa | ||
| + | tatattcagagcctgattgatcgctttaccgcggaagcgcgcaacccgcagggccgccgc | ||
| + | gtgcgcaaagaatatcgcatgatgaccaacgaagaacgcgataactatcatcgcgcgatt | ||
| + | gtgatgctgaaacaggataccaccgtgctgccgaacaaatttgaaattattgcggatctg | ||
| + | catgcgggcagcgtgaccaacagcgcgcatggcggcccgggctttctgccgtggcatcgc | ||
| + | atttatatgatgatttgggaagaaggcctgcgcgaacaggtgccgaccgtggtggtgccg | ||
| + | tattgggatgtgacccgcgatagcgcgatggatgatccgcgccgcagcattgtgtggagc | ||
| + | ccgcagtttcagggcaacggccatggcctggtgaccgtgggcccgtttgcggattggacc | ||
| + | accggctatggcccgctgcatcgcaactatgcggtgtttacccatctgctgacccgcgcg | ||
| + | aacattcagaccgtgtttaccgaacgcaccattgcggaaattagccagctgaccgcgaac | ||
| + | gatcagcgctatgtgtttgaactgtatcataacaacattcatgattggattggcggcacc | ||
| + | gtgagcgtgcaggcgtgggcgagctttgatccggcgtttatgctgattcatggctatgtg | ||
| + | gattatatttggtatcgctttcaggaaatgcagctggaactgggcggcattgatattagc | ||
| + | gtggattatccgtttaccgcgaaccatcagattctgaacggcaccgcgtttgatggcgaa | ||
| + | gaaccggtgggcctgattccgggcatgaccaaccgcgaagcggtggcggaaggcgtggtg | ||
| + | tatatgaacctgatgaactatgaagaagcgcagagcgattgcgatcagcagaccccgtgc | ||
| + | ccgccgaactatgaatgcgtggatggcttttgcgcgagccgcgcggtggataacgatgtg | ||
| + | tgcaaccagattcagccgctgcagaacaacttttgcattaacaaagaatgcgatgtgagc | ||
| + | ctgtttagctttctggcggtggaaattattcatgaacgcatggaaaacctgtgcaacatg | ||
| + | ggcaactttccggtgcgccagtggctggcggataaaaccgcggatatttatcgcgaaagc | ||
| + | gcgagcgtgattcatcagggcaaatatagcaacagcctgagcgatatgtgcggccgcccg | ||
| + | ggcggctgctgcaaaccggtggaacgcgtgaacattcaggtgagcggcaacgatggcgat | ||
| + | ctgtggctgtatcgcgaaagcgcgtttgtggatgcgcgcctggcggtgagccatagccag | ||
| + | atgtttgtggcggtgcgccgcgtgccgattggccgctttctgatttttgcggcggatgaa | ||
| + | tatggcaacctgtgcgatgcgtatctggtggatacctttggcaacaaaattctgctgcgc | ||
| + | cgcagcgaaggcattattattagcgaagatgatccgcgcctgagcaacaccctggcggaa | ||
| + | gcggaaagcaaaatgtttgattatcagaacggccaggatctgccgccgaacgtgctgcag | ||
| + | aaccagtatgtgctgagctttcattgccgcgcggatcgcaacctgggcccgagcgtgcgc | ||
| + | Aacggcaacaaaaaa | ||
| + | |||
| + | <br><br> >Standard RBS | ||
| + | <br>>BBa_B0034 Part-only sequence (12 bp) | ||
| + | <br>aaagaggagaaa | ||
| + | <br>(TIPS- dont use T7 promoter as it is derived from virus find others) | ||
| + | |||
| + | |||
| + | <br><br>>CODON OPTIMISED AND RFC{10} compatibale Tyrosinase precursor | ||
| + | 1 ATGGAATCTT ATCGCCTGCT GGTGCTGGTT TCTGCTTTTG GCCTGTGCCA GGCCATGGTT GATGTTTCTC | ||
| + | 71 AGAGCGACGG CCTGCAAAGC TGTCTGGATC GCTTCGCTGA CGATACGAGC ACGTTTAGCC AGCAAGAACA | ||
| + | 141 GCTGAGCCTG TGTTCCAAAT ACTATATGCA GAAAAATTGG AAATCTGCGG ATGTTAGCAA ACCGAAAATC | ||
| + | 211 TCTACCCTGG CGACTATGAG CCCGCAGGAG TACATTCAGA GCCTGATCGA TCGTTTCACC GCAGAAGCAC | ||
| + | 281 GTAACCCGCA GGGTCGTCGC GTTCGTAAAG AGTACCGCAT GATGACCAAT GAAGAACGCG ATAACTACCA | ||
| + | 351 CCGTGCGATC GTGATGCTGA AACAGGACAC TACGGTGCTG CCGAACAAGT TCGAGATCAT CGCAGACCTG | ||
| + | 421 CATGCTGGTT CCGTAACCAA CAGCGCACAT GGTGGTCCAG GCTTTCTGCC GTGGCATCGC ATTTACATGA | ||
| + | 491 TGATCTGGGA AGAAGGCCTG CGCGAGCAAG TTCCGACTGT TGTAGTCCCT TATTGGGATG TCACCCGCGA | ||
| + | 561 TTCCGCTATG GACGATCCTC GTCGCAGCAT CGTTTGGAGC CCACAGTTTC AGGGCAACGG CCACGGCCTG | ||
| + | 631 GTTACCGTTG GTCCGTTCGC TGACTGGACG ACCGGTTACG GTCCTCTGCA CCGTAACTAT GCCGTTTTCA | ||
| + | 701 CCCACCTGCT GACCCGTGCG AACATCCAGA CTGTTTTCAC CGAACGTACT ATCGCAGAGA TCAGCCAACT | ||
| + | 771 GACCGCGAAC GATCAGCGTT ATGTATTTGA GCTGTACCAC AACAATATCC ACGATTGGAT TGGTGGTACT | ||
| + | 841 GTATCCGTCC AGGCATGGGC AAGCTTCGAT CCGGCTTTCA TGCTGATTCA CGGTTATGTG GACTACATCT | ||
| + | 911 GGTACCGCTT CCAGGAAATG CAGCTGGAAC TGGGTGGTAT TGACATTAGC GTTGACTACC CGTTCACCGC | ||
| + | 981 GAACCACCAG ATCCTGAACG GTACCGCATT TGATGGTGAG GAACCGGTAG GCCTGATCCC TGGCATGACC | ||
| + | 1051 AACCGTGAAG CAGTGGCGGA AGGCGTGGTA TACATGAACC TGATGAATTA CGAAGAAGCA CAGTCCGACT | ||
| + | 1121 GTGATCAGCA GACCCCGTGT CCGCCGAACT ACGAATGTGT TGATGGTTTT TGCGCATCTC GTGCAGTAGA | ||
| + | 1191 TAACGACGTT TGCAACCAGA TCCAGCCTCT GCAAAACAAC TTCTGCATTA ACAAAGAATG CGATGTTAGC | ||
| + | 1261 CTGTTCAGCT TCCTGGCGGT CGAAATCATC CACGAACGCA TGGAAAACCT GTGTAATATG GGCAACTTCC | ||
| + | 1331 CGGTACGTCA GTGGCTGGCG GATAAAACGG CGGACATTTA CCGTGAATCC GCTTCTGTGA TCCATCAGGG | ||
| + | 1401 TAAATACAGC AACTCTCTGT CTGATATGTG TGGCCGTCCA GGTGGCTGCT GCAAACCGGT TGAACGTGTC | ||
| + | 1471 AATATCCAGG TATCCGGCAA TGATGGTGAC CTGTGGCTGT ACCGCGAAAG CGCTTTCGTT GACGCCCGTC | ||
| + | 1541 TGGCTGTATC CCATAGCCAG ATGTTCGTTG CGGTACGTCG CGTGCCGATT GGTCGTTTCC TGATCTTCGC | ||
| + | 1611 AGCAGACGAA TACGGCAACC TGTGCGATGC ATACCTGGTT GATACTTTTG GTAACAAAAT TCTGCTGCGT | ||
| + | 1681 CGCTCCGAAG GCATCATCAT TTCTGAAGAT GACCCGCGTC TGTCTAACAC CCTGGCGGAA GCAGAAAGCA | ||
| + | 1751 AGATGTTCGA CTATCAGAAT GGTCAAGATC TGCCACCAAA CGTTCTGCAA AACCAATATG TTCTGTCCTT | ||
| + | 1821 CCACTGCCGT GCAGACCGCA ACCTGGGTCC ATCTGTTCGT AACGGTAACA AAAAA | ||
| + | |||
| + | |||
| + | <br><br>>reverse translation of BAC87843.1 tyrosinase precursor 1 [Illex argentinus] to a 1875 base sequence of consensus codons. | ||
| + | atggarwsntaymgnytnytngtnytngtnwsngcnttyggnytntgycargcnatggtn | ||
| + | gaygtnwsncarwsngayggnytncarwsntgyytngaymgnttygcngaygayacnwsn | ||
| + | acnttywsncarcargarcarytnwsnytntgywsnaartaytayatgcaraaraaytgg | ||
| + | aarwsngcngaygtnwsnaarccnaarathwsnacnytngcnacnatgwsnccncargar | ||
| + | tayathcarwsnytnathgaymgnttyacngcngargcnmgnaayccncarggnmgnmgn | ||
| + | gtnmgnaargartaymgnatgatgacnaaygargarmgngayaaytaycaymgngcnath | ||
| + | gtnatgytnaarcargayacnacngtnytnccnaayaarttygarathathgcngayytn | ||
| + | caygcnggnwsngtnacnaaywsngcncayggnggnccnggnttyytnccntggcaymgn | ||
| + | athtayatgatgathtgggargarggnytnmgngarcargtnccnacngtngtngtnccn | ||
| + | taytgggaygtnacnmgngaywsngcnatggaygayccnmgnmgnwsnathgtntggwsn | ||
| + | ccncarttycarggnaayggncayggnytngtnacngtnggnccnttygcngaytggacn | ||
| + | acnggntayggnccnytncaymgnaaytaygcngtnttyacncayytnytnacnmgngcn | ||
| + | aayathcaracngtnttyacngarmgnacnathgcngarathwsncarytnacngcnaay | ||
| + | gaycarmgntaygtnttygarytntaycayaayaayathcaygaytggathggnggnacn | ||
| + | gtnwsngtncargcntgggcnwsnttygayccngcnttyatgytnathcayggntaygtn | ||
| + | gaytayathtggtaymgnttycargaratgcarytngarytnggnggnathgayathwsn | ||
| + | gtngaytayccnttyacngcnaaycaycarathytnaayggnacngcnttygayggngar | ||
| + | garccngtnggnytnathccnggnatgacnaaymgngargcngtngcngarggngtngtn | ||
| + | tayatgaayytnatgaaytaygargargcncarwsngaytgygaycarcaracnccntgy | ||
| + | ccnccnaaytaygartgygtngayggnttytgygcnwsnmgngcngtngayaaygaygtn | ||
| + | tgyaaycarathcarccnytncaraayaayttytgyathaayaargartgygaygtnwsn | ||
| + | ytnttywsnttyytngcngtngarathathcaygarmgnatggaraayytntgyaayatg | ||
| + | ggnaayttyccngtnmgncartggytngcngayaaracngcngayathtaymgngarwsn | ||
| + | gcnwsngtnathcaycarggnaartaywsnaaywsnytnwsngayatgtgyggnmgnccn | ||
| + | ggnggntgytgyaarccngtngarmgngtnaayathcargtnwsnggnaaygayggngay | ||
| + | ytntggytntaymgngarwsngcnttygtngaygcnmgnytngcngtnwsncaywsncar | ||
| + | atgttygtngcngtnmgnmgngtnccnathggnmgnttyytnathttygcngcngaygar | ||
| + | tayggnaayytntgygaygcntayytngtngayacnttyggnaayaarathytnytnmgn | ||
| + | mgnwsngarggnathathathwsngargaygayccnmgnytnwsnaayacnytngcngar | ||
| + | gcngarwsnaaratgttygaytaycaraayggncargayytnccnccnaaygtnytncar | ||
| + | aaycartaygtnytnwsnttycaytgymgngcngaymgnaayytnggnccnwsngtnmgn | ||
| + | Aayggnaayaaraar | ||
| + | |||
| + | <br><br>Cephalopod ink contains a number of chemicals in a variety of different concentrations, depending on the species. However, its main constituents are melanin and mucus. It can also contain, among other things, tyrosinase, dopamine and L-DOPA, as well as small amounts of free amino acids, including taurine, aspartic acid, glutamic acid, alanine and glycine. Cephalopod ink has, as its name suggests, been used in the past as ink for pens and quills; the Greek name for cuttlefish, and the taxonomic name of a cuttlefish genus, Sepia, is associated with the brown colour of cuttlefish ink (for more information, see sepia). | ||
| + | Modern use of cephalopod ink is generally limited to cooking, primarily in Japan and the Meditteranean , where it is used as a food coloring and flavouring, for example in pasta and sauces. For this purpose it is generally obtainable from fishmongers, gourmet food suppliers, and is widely available in markets in Japan. The ink is extracted from the ink sacs during preparation of the dead cephalopod, usually cuttlefish, and therefore contains no mucus. | ||
| + | Studies have shown that cephalopod ink is toxic to some cells, including tumour cells. It is being researched in mice for its antitumor activity against Meth-A fibrosarcoma. It currently remains unclear however if any of the antitumor activity of squid ink can be obtained from oral consumption, and this is indicated as an area for future investigation. | ||
| + | Tyrosinase activity is very important. If uncontrolled during the synthesis of melanin, it results in increased melanin synthesis. Decreasing tyrosinase activity has been targeted for the betterment or prevention of conditions related to hyperpigmentation of the skin, such as melasma and age spots. | ||
| + | Antimicrobial activity of tyrosinase The antimicrobial activity of tyrosinase was assayed against Salmonella typhimurium [ATCC 14028], Staphylococcus aureus subsp. aureus[ATCC 25923], Staphlococcus aureus [MRSA] [ATCC 43300], Bacillus cereus [ATCC 33018], Bacillus subtilis subsp spizizenii [ATCC 6633], Listeriamonocyogenes [ATCC 7644], Listeria innocua [ATCC 33090], Escherichia coli [ATCC 11775], Pseudomonas aerugmosa [ATCC 10145] Candida albicans [ATCC 26555] and Aspergillus niger [nrrl 326] [19]. The susceptibility was assayed using CLCI, M44A on Mueller Hinton agar plate.Out of nine tested pathogenic bacterial species, the enzyme could inhibit the growth of four species only, Bacillus subtilis, Staphylococcus aureus subsp. aureus, Pseudomonas aeruginosa and Escherichia coli, with inhibition zone diameters of 9, 7, 6 and 6 mm, respectively [Table 9]. Tyrosinase showed no antifungal activity either on the filamentous fungal species Aspergillus niger or on the unicellular fungal species Candida albicans. No available data could be obtained in that field except that of Nosanchuk and Casaevell [63] who reported an antimicrobial action of tyrosinase which contributed to microbial pathogenesis. | ||
| + | |||
| + | |||
| + | |||
| + | <br><br>Sepia pharaonis | ||
| + | <br>Common cuttlefish | ||
| + | <br>>tr|Q7YT36|Q7YT36_SEPOF Tyrosinase OS=Sepia officinalis OX=6610 PE=2 SV=1 | ||
| + | MSLFGICKAMVNISQSNMLQNCFDRFASDSSILTEQEQVSLCFKYYTQNNLQSADVPNSK | ||
| + | VSPLATMTPEEYIQSLIGRFTAEARNPQNKRVHKEYRMMTNEERENYHQAIIMLKQDTTV | ||
| + | LPNKFEVIADLHVGFITNSAHGGPGFLPWHRIYMMIWEEGLREQIPSVVVPYWDVTRDSA | ||
| + | LEDPRRSIIWSPEFQGNGHGLVTSGPFAGWLTGYGPLHRNYAVFTHLLTRENVRTVFTQK | ||
| + | SLAQISQLTANEQRYIFELYHNNIHDWIGGTVSVQAWASFDPAFMLIHGYVDYIWYRFQE | ||
| + | MQLEANINISEDYPMTSNHQILNGTAFDADAPIGIIAGMSNREAVAESVVYMNLIDYEEA | ||
| + | PTDCDEETPCGSPYYECVNGFCASRIIANDVCSQTIPLQNNFCVDKICDTGLFSFLPVEV | ||
| + | IHERLESLCDMSNFPVRQWVPDNTMDIYRESANIVHQDRYFNRPSDMCGRPGGCCKPVER | ||
| + | VNIQVNGNDGNLWLYKESVYVDTRLAVSHSHMFVAIKRAPIGRFLIFAADEYGNLCDTYL | ||
| + | LDTFGNRILLRRNEGIIISENDQRISSTLAEAELKMFNYVTGQSLPTVRQDQYVISFHCR | ||
| + | ADRNQN | ||
| + | |||
| + | <br><br>Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold) | ||
| + | <br>>sp|Q00234|TYRO_ASPOR Tyrosinase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=melO PE=1 SV=1 MASVEPIKTFEIRQKGPVETKAERKSIRDLNEEELDKLIEAWRWIQDPARTGEDSFFYLA GLHGEPFRGAGYNNSHWWGGYCHHGNILFPTWHRAYLMAVEKALRKACPDVSLPYWDESD DETAKKGIPLIFTQKEYKGKPNPLYSYTFSERIVDRLAKFPDADYSKPQGYKTCRYPYSG LCGQDDIAIAQQHNNFLDANFNQEQITGLLNSNVTSWLNLGQFTDIEGKQVKADTRWKIR QCLLTEEYTVFSNTTSAQRWNDEQFHPLESGGKETEAKATSLAVPLESPHNDMHLAIGGV QIPGFNVDQYAGANGDMGENDTASFDPIFYFHHCFIDYLFWTWQTMHKKTDASQITILPE YPGTNSVDSQGPTPGISGNTWLTLDTPLDPFRENGDKVTSNKLLTLKDLPYTYKAPTSGT GSVFNDVPRLNYPLSPPILRVSGINRASIAGSFALAISQTDHTGKAQVKGIESVLSRWHV QGCANCQTHLSTTAFVPLFELNEDDAKRKHANNELAVHLHTRGNPGGQRVRNVTVGTMR | ||
| + | <br>Solenopsis invicta (Red imported fire ant) (Solenopsis wagneri) | ||
| + | <br>>sp|Q8WP90|PBGP9_SOLIN Pheromone-binding protein Gp-9 OS=Solenopsis invicta OX=13686 GN=Gp-9 PE=1 SV=1 | ||
| + | MKTFVLHIFIFALVAFASASRDSARKIGSQYDNYATCLAEHSLTEDDIFSIGEVSSGQHK | ||
| + | TNHEDTELHKNGCVMQCLLEKDGLMSGADYDEEKMREDYIKETGAQPGDQRIEALNACMQ | ||
| + | ETKDMEDKCDKSLLLVACVLAAEAVLADSNEGA | ||
| + | |||
| + | <br><br>Solenopsis invicta virus 3 (SINV-3) | ||
| + | <br> >sp|C1JCT1|POL_SINV3 Polyprotein OS=Solenopsis invicta virus 3 OX=631345 PE=1 SV=1 | ||
| + | MSEKTQTFVQNETHVLDMTSDFKSDLSLEKVTSSVEQTDDLVSKIINNNDLDIKDLSFLR | ||
| + | NLLLSTLQYLGIAKFVAINITLSILSILMLLINSCAKFTRIVNLSSHILNIITTLGLYFQ | ||
| + | VSSMEIEEITQTFENEFGTYDDDKILSHYIKICNLPNRKDVYEYISLNDLKYKIKLPDIS | ||
| + | FYELKNDILSKNKNLHLWIFQKFTDEFLAMWFGVQPYRISNLREMLVISRQGFIPKDLFN | ||
| + | EIRKLCNMGVSVIISFIQSKLFDEPFKKRDCTQALKDASVISSPFDTLWNLISKQVCDNS | ||
| + | AEERFTQTILDFTSEFDNFLGIPNYKFAKNQKLVNTISKSLDACAKFIRDCPKDKQTEIF | ||
| + | PLQGLHTATVKRRNEILTNVMPKFARQEPFVVLFQGPGGIGKTHLVQQLATKCVNSFYQD | ||
| + | HEDDYIEISPDDKYWPPLSGQRVAFFDEAGNLNDLTEDLLFRNIKSICSPAYFNCAAADI | ||
| + | EHKISPCPFELVFATVNTDLDTLQSKISSTFGQASVFPIWRRCIVVECSWNEKELGPFNY | ||
| + | KNPSGHRSDYSHITMNYMSYDDKTQKLALEKEINFDTLFDMIRLRFRKKQQEHDTKISIL | ||
| + | NNEIQRQSNSKQHFSVCLYGEPGQGKTYNLNKLITTFANATNLKIGSEEKPSIHIFDDYI | ||
| + | KDENDENCSKFMDIYNNKLPNNSVIFSATNVYPKTHFFPTFFLTNLIYAFIQPFKQVGLY | ||
| + | RRLGFDGYTDIPNSSVNAPIFVQNFKFYERKQHICYFLSLEFLKNIICYIFFFLYFPLKF | ||
| + | IKKIDLIEIKDVNKYVYDRYINFLSLSKQIEIVEYPPNLENVEFDFRFNMNKFHRVSFNN | ||
| + | PFELDKYIHFNKNSYENLLHFDWKMYLSPRVKHRLALSYEKFFITISEVNKEIIIEELKR | ||
| + | YVLLFKQFNIDPNMEINLGEYGSFYYINGKIHLMTINIESNVSEIPVFTDGDYVYISEHK | ||
| + | IPVIDLFDNININSKYNLSFDQSIALNSFKTGDSFYSNAKVRKSLSKFVLLNYQTKFKLY | ||
| + | LKEAKDKVKNFIETPIGHLLSILLTIFVICYASFKIYSKFSNFFSKDQAIEDQRKGEKKI | ||
| + | KKITNYDSDGVQPQRKGEKKIKKVTNYDSDGVQPQSNVKVEEEIKLVFDPTGQKLLFGND | ||
| + | FTSELETLVELEKDDEEFTKSKIDNKSMAGLRREVRRRRYARSKKAQIEKQEVLTLPDVN | ||
| + | GFEGGKPYFQIAEEKARKNLCQIYMIANNENCIASKFSDHIVCYGLFVFKKRLASVGHIV | ||
| + | EALKCAPGYNLYAGCDQFNGKLYKMNLVRNYRKRELSVWDVDCPNDFVDLTSFFIPKEEL | ||
| + | YDAENCNTVLGRFGMNKREVYLYGNCEFIQEFFKVDNKGAQEFGYIDWATVDITLTTGGD | ||
| + | CGLPYYICERKKFHNKIMGLHFAGNNVNHKTIGMSALIYKEDLVVWKGAERQSKCKFCDV | ||
| + | KDIIIAQPDIPKEKYKGYNHEIVWNSLHESSPTTLNEELEHYLNIFPKFTGTIIKHSGDK | ||
| + | FYGSVKHSHTQFISKFKTELTVTNGWKLSTAGDCQFESNHISPNTEVMYRVVDVQFNSIF | ||
| + | KAFKSQPYIKNFRLIANVYEKDGKQRVTILTIIPVSDFNVKQQTVRQALVPLHLNEDEEV | ||
| + | YVTEDVSDIFKTAIKRKQRGILPDVPYETVENETVEILGITHRNMTPEPAQMYKPTPFYK | ||
| + | LALKFNLDHKLPVNFNMKDCPQEQKDMMVLDRLGQPNPRITQSLKWAHKDYSPDYELRKY | ||
| + | VKEQYMCNIMEYYAGCNLLTEEQILKGYGPNHRLYGALGGMEIDSSIGWTMKELYRVTKK | ||
| + | SDVINLDSNGNYSFLNNEAAQYTQELLKISMEQAHNGQRYYTAFNELMKMEKLKPSKNFI | ||
| + | PRTFTAQDLNGVLMERWILGEFTARALAWDENCAVGCNPYATFHKFATKFFKFKNFFSCD | ||
| + | YKNFDRTIPKCVFEDFRDMLIQANPHMKNEIYACFQTIIDRIQVSGNSILLVHGGMPSGC | ||
| + | VPTAPLNSKVNDIMIYTAYVNILRRADRGDITSYRYYRDLVCRLFYGDDVIIAVDDSIAD | ||
| + | IFNCQTLSEEMKILFGMNMTDGSKSDIIPKFETIETLSFISRFFRPLKHQENFIVGALKK | ||
| + | ISIQTHFYYATDDTPEHFGQVFKTIQEEAALWEEEYFNKIQSYIQEIIRKFPEISKFFNF | ||
| + | ESYKSIQKRYIMNGWNEFVKLEKLDLNLNKKKSSKVTGIHSKQYSKFLKFLSRIENEKAA | ||
| + | LEGNFNKESVNTWYFKMSKAMHLNEIFQKGLISKPLAEFYFNEGQKMWDCNITFRRSKDD | ||
| + | LPFTFSGSGTTKACAREQAAEEALVLFSQEDEIVRQINDIQSDCKFCKKMIRYKKLLSGV | ||
| + | SIQRQMNVSKITENHVPSAGMMATDPSVAPDSGIATNTQTPSISRVLNPIARALDNPAGT | ||
| + | GAPFDKHTYVYNVFTRWPEMSTVVNKSLAAGAEVFKISLDPNKLPKRILQYIQFHKTIIP | ||
| + | QIEVQILIGGAAGTVGWLKVGWVPDASTAKKYSLDDLQLVASETINLNSTITMSMIINDS | ||
| + | RRNGMFRLTKSDPEPWPGIVCLVEHPITNVQRNDDVNYPVIVSVRLGPDCQLMQPYNDLN | ||
| + | |||
| + | |||
| + | |||
| + | Aestero saponins | ||
| + | |||
| + | |||
| + | <br><br>>sp|P84117|1-51 | ||
| + | FNKLKQGSSKRTCAKCFRKIMPSVHELDERRRGANRWAAGFRKCVSSICRY | ||
| + | |||
| + | |||
| + | |||
| + | |||
| + | |||
| + | |||
| + | |||
| + | <br><br>Hymenoptaecin | ||
| + | |||
| + | |||
| + | <br>>sp|Q10416|HYTA_APIME Hymenoptaecin OS=Apis mellifera OX=7460 PE=2 SV=1 | ||
| + | MKFIVLVLFCAVAYVSAQAELEPEDTMDYIPTRFRRQERGSIVIQGTKEGKSRPSLDIDY | ||
| + | KQRVYDKNGMTGDAYGGLNIRPGQPSRQHAGFEFGKEYKNGFIKGQSEVQRGPGGRLSPY | ||
| + | FGINGGFRF | ||
| + | |||
| + | |||
| + | |||
| + | |||
| + | |||
| + | |||
| + | <br><br>Reverse transciption | ||
| + | <br>Reverse Translate results | ||
| + | <br>Results for 129 residue sequence "sp|Q10416|HYTA_APIME Hymenoptaecin OS=Apis mellifera OX=7460 PE=2 SV=1" starting "MKFIVLVLFC" | ||
| + | |||
| + | <br>>reverse translation of sp|Q10416|HYTA_APIME Hymenoptaecin OS=Apis mellifera OX=7460 PE=2 SV=1 to a 387 base sequence of most likely codons. | ||
| + | atgaaatttattgtgctggtgctgttttgcgcggtggcgtatgtgagcgcgcaggcggaa | ||
| + | ctggaaccggaagataccatggattatattccgacccgctttcgccgccaggaacgcggc | ||
| + | agcattgtgattcagggcaccaaagaaggcaaaagccgcccgagcctggatattgattat | ||
| + | aaacagcgcgtgtatgataaaaacggcatgaccggcgatgcgtatggcggcctgaacatt | ||
| + | cgcccgggccagccgagccgccagcatgcgggctttgaatttggcaaagaatataaaaac | ||
| + | ggctttattaaaggccagagcgaagtgcagcgcggcccgggcggccgcctgagcccgtat | ||
| + | tttggcattaacggcggctttcgcttt | ||
| + | |||
| + | >reverse translation of sp|Q10416|HYTA_APIME Hymenoptaecin OS=Apis mellifera OX=7460 PE=2 SV=1 to a 387 base sequence of consensus codons. | ||
| + | atgaarttyathgtnytngtnytnttytgygcngtngcntaygtnwsngcncargcngar | ||
| + | ytngarccngargayacnatggaytayathccnacnmgnttymgnmgncargarmgnggn | ||
| + | wsnathgtnathcarggnacnaargarggnaarwsnmgnccnwsnytngayathgaytay | ||
| + | aarcarmgngtntaygayaaraayggnatgacnggngaygcntayggnggnytnaayath | ||
| + | mgnccnggncarccnwsnmgncarcaygcnggnttygarttyggnaargartayaaraay | ||
| + | ggnttyathaarggncarwsngargtncarmgnggnccnggnggnmgnytnwsnccntay | ||
| + | Ttyggnathaayggnggnttymgntty | ||
| + | |||
| + | </p> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="modal"> | ||
| + | <div class="modal-content"> | ||
| + | <span class="close">×</span> | ||
| + | <h2>Model testing using various media</h2> | ||
| + | <p><BR>Date- 15th September | ||
| + | <BR>Apeksha | ||
| + | <BR><BR>Aim- To see the effect of UV on organisms growing on different media. | ||
| + | <BR><BR>Protocol- | ||
| + | <BR>Step 1 - Prepare Luria Bertani agar, nutrient agar, MacConkey agar, Mueller Hinton agar, Sabourauds agar | ||
| + | <BR>Step 2 - Pour non- sterile media into sterile plates aseptically. | ||
| + | <br>Step 3 - Expose plates to UV in the UVC chamber for 5 minutes | ||
| + | <br>Step 4 - Incubate at room temperature for 24 hours. | ||
| + | <br>Step 5 - Observe | ||
| + | <br><br>Result - MacConkey media and LB media showed minimum growth of organisms and Mueller Hinton agar showed very scanty growth of contaminants.Maximum growth was found in Nutrient agar.</p> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <div class="modal"> | ||
| + | <div class="modal-content"> | ||
| + | <span class="close">×</span> | ||
| + | <h2>Prototype building</h2> | ||
| + | <p> | ||
| + | Aim - To build a prototype of our experiment using CAD model | ||
| + | Ashtad | ||
| + | |||
| + | </p> | ||
| + | </div> | ||
| + | </div> | ||
| + | |||
| + | <script> | ||
| + | var i; | ||
| + | var span = document.getElementsByClassName("close"); | ||
| + | var btn = document.getElementsByClassName("myBtn"); | ||
| + | var modal; | ||
| + | |||
| + | function openModal(x) { | ||
| + | modal = document.getElementsByClassName("modal"); | ||
| + | modal[x].style.display = "block"; | ||
| + | |||
| + | span[x].onclick = function() { | ||
| + | modal[x].style.display = "none"; | ||
| + | }; | ||
| + | |||
| + | window.onclick = function(event) { | ||
| + | if (event.target == modal[x]) { | ||
| + | modal[x].style.display = "none"; | ||
| + | } | ||
| + | }; | ||
| + | } | ||
| + | </script> | ||
| + | </body> | ||
</html> | </html> | ||
Latest revision as of 21:38, 21 October 2019
Experiments
Experiment No. 1
Testing the efficiency of nichrome wire
- Aim: To check whether the current passed through nichrome wire increase the temperature.
- Result: The average time required for a 10 °C rise was determined to be 4.2 seconds. Thus, 0.56sec for a 1 °C rise in temperature.
Experiment No. 2
Using nichrome wire
- Aim: To determine the time required for the water to raise the temperature by 1 °C using nichrome loop.
- Result: Thus, it takes 1mins 12sec to raise the temperature from 25 °C to 100 °C, so 0.96sec is taken to rise 1 °C in temperature for water.
Experiment No. 3
Sterilize NA media by direct heating using nichrome wire
- Aim: To determine the time required for the media to raise the temperature by 1 °C.
- Result: Thus it takes 45 seconds to raise the temperature of the medium from 25 °C to 100 °C.
Experiment No. 4
Sterilize media by indirect heating using oil along with nichrome wire (wrapped around the flask containing oil)
- Aim: To determine the time required to raise the temperature of the media from 25 °C to 100°C using a nichrome wire tied around a flask containing oil which has the medium immersed into it.
- Result: This method is not as efficient.
Experiment No. 5
Sterilize media by indirect heating using oil with nichrome wire wrapped around the tube and dipped in oil.
- Aim: To determine the time required to raise the temperature of water from 25 °C to 100 °C using nichrome wire directly wrapped around tube and dipped in flask containing oil for heat preservation.
- Result: This method was ruled out.
Experiment No. 6
Sterilize media by indirect sterilization using powder ink
- Aim: To determine the time required to raise the temperature of water from 25 °C to 100 °C by using ink powder particles (magnetic) by holding over induction coils.
- Result: Method ruled out.
Experiment No. 7
Viscosity checking of medium that can be used
- Aim: To check the time required for water, and various media to flow through Ostwald's viscometer.
- Result: Liquid media passed easily through the tiny capillary whereas heated agar was very difficult to pass. Hence tubing dimensions could be decided for further manufacture.
Experiment No. 8
Developing UV Chamber
- Aim: Circuit assembly inside an acrylic chamber with holding space for petri dishes in the centre. UV- C tubes installed inside the chamber on top and bottom to evenly irradiate the plates.
Experiment No. 9
Sterilize using UV-C germicidal tube
- Aim: To determine effectivity of the manufactured UVC chamber by exposing plates with plain unsterilized medium to UV radiation for varied amounts of time and incubation of plates and enumeration.
- Result: 8 minutes of exposure to UV was enough for killing microbial population in media.
Experiment No. 10
Media preparation
- Aim: Preparation of 250 ml Sabourauds agar and 24 petri plates and set it for autoclaving.
Experiment No. 11
Endophyte experiment
- Aim: Isolation of endophytes from Neem (Azadirachta indica) and Tulsi (Ocimum tenuiflorum).
- Result: Presence of Endophytes have been observed and they have been screened for further use.
Experiment No. 12
Subculturing of endophytes to obtain a pure-culture
Experiment No. 13
Replating of colonies
- Aim: Replating and segregation of colonies.
Experiment No. 14
Isolation of grown colonies
- Aim: Isolation of various different colonies found on sabourauds plates which had plant parts.
- Result: There were pure culture growth of colonies with no other colony presence.
Experiment No. 15
Checking growth
- Observations: Most plates showed pure culture characteristics. These colonies were chosen.
Experiment No. 16
Mass culture
- Aim: Making large amounts of the chosen culture.
Experiment No. 17
CAD modeling of U.V. chamber using AutoCAD Software
Experiment No. 18
New UV - C chamber manufacture
Experiment No. 19
Testing UVC chamber using plates
- Aim: To test microbicidal effect of the new UVC assembly by using plates. Preparation of NB and using 9 plates to test for U.V. (for 2,4,6,8,10mins closed plate, 5mins closed, 5mins open).
- Result: 5 minutes were enough to sterilize the media under this new chamber.
Experiment No. 20
Spiral Tube experiments
Experiment No. 21
Exploration of desired genes
- Aim: To select a protein/compound secreted by organism that has killing/ inhibitory activity on contaminating organisms.
Experiment No. 22
Model testing using various media
- Aim: To see the effect of UV on organisms growing on different media.
- Result: MacConkey media and LB media showed minimum growth of organisms and Mueller Hinton agar showed very scanty growth of contaminants.Maximum growth was found in Nutrient agar.
Experiment No. 23
Prototype building
- Aim: To build a prototype of our experiment using CAD model.